Clone RE34140 Report

Search the DGRC for RE34140

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:341
Well:40
Vector:pFlc-1
Associated Gene/TranscriptPGRP-LB-RC
Protein status:RE34140.pep: gold
Sequenced Size:1271

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14704 2004-01-14 Blastp of sequenced clone
PGRP-LB 2008-04-29 Release 5.5 accounting
PGRP-LB 2008-08-15 Release 5.9 accounting
PGRP-LB 2008-12-18 5.12 accounting

Clone Sequence Records

RE34140.complete Sequence

1271 bp (1271 high quality bases) assembled on 2004-01-14

GenBank Submission: BT011455

> RE34140.complete
AACTTTCGCGCTTTATACGCTTGATACGAAGCATAACGCCGCTATGTGAG
CGCTGCCGCACCAAAGTCTGACCTTCACACACTGTCGAAATTTTGCACAA
CTCTTGCCACAAAGCAAAAAAAAAATAAACGGTAGCAGTCAGCCAGCAAA
CAAACAACGCTGCAAGCAAACCAACAAACAAACAAAGAAACAAACAAACA
CAAAAATAAACAAACAAACAAGACAAGAAACAAACAGCGACTAGCAGTCG
ATACAAAAGTTCCTAAATCCAAGTCACAGTTCCTAAGCAGTTGGATTGCA
GCAGCACTAACTTCGCAACAGCAGCAGCAACTTGGCAACAGCAGCAACAT
CGCAACAGCAGCAGCAACTTCGCAGCAACAGCAGCTAAAAGCAGCAACAT
GACAGCACTGGGATTAGTTCTGCTATCGATGATGGGCTATAGTCAGCACA
TGCAGCAGGCGAATCTGGGCGACGGTGTGGCCACCGCCCGCCTGCTGTCC
CGATCCGACTGGGGTGCCCGGCTGCCCAAGTCCGTGGAGCACTTCCAGGG
TCCCGCGCCCTACGTCATCATCCATCACTCGTACATGCCGGCCGTGTGCT
ACTCCACTCCGGACTGCATGAAGAGCATGCGGGACATGCAGGACTTCCAT
CAGCTGGAGCGCGGATGGAACGATATTGGTTATAGCTTTGGCATCGGCGG
CGATGGCATGATTTACACCGGCAGGGGATTCAATGTCATCGGAGCTCATG
CACCCAAGTACAATGACAAGAGCGTGGGCATTGTGCTGATCGGAGATTGG
AGAACCGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAAGAACCTGAT
CGCCTTTGGCGTTTTCAAGGGCTACATTGACCCTGCCTACAAGCTGCTGG
GCCACCGACAGGTGCGGGATACCGAGTGTCCTGGCGGCCGCCTGTTCGCC
GAGATCTCCAGCTGGCCGCACTTTACCCACATAAACGACACCGAAGGCGT
CAGCAGCACCACGGCGCCCGTCGTGCCCCACGTCCATCCACAGGCGGCAG
CACCACAAAAGCCGCACCAATCCCCGCCAGCTGCGCCCAAGGTCTAGGCT
GGATTGGAGGGCCCTCATCGTCCTCGCAAAGCTTACGAGTTTAAGAGAAG
CCACAACGAGCTCGGCTCCACGCACAACGCCAAGGAGTTCATTCAGTATT
CATTAGATGTCTCTTCTAACATTTCACAAATAAAGCAATTTCTAGATGAT
AACACAAAAAAAAAAAAAAAA

RE34140.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:08:06
Subject Length Description Subject Range Query Range Score Percent Strand
PGRP-LB-RC 1529 PGRP-LB-RC 189..1443 1..1255 6260 99.9 Plus
PGRP-LB.a 1054 PGRP-LB.a 205..1025 435..1255 4105 100 Plus
PGRP-LB.c 1058 PGRP-LB.c 199..1019 435..1255 4105 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:08:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 7278321..7278771 1255..805 2255 100 Minus
chr3R 27901430 chr3R 7283070..7283505 436..1 2165 99.8 Minus
chr3R 27901430 chr3R 7278924..7279293 804..435 1850 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:50:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:08:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11452849..11453299 1255..805 2255 100 Minus
3R 32079331 3R 11457585..11458020 436..1 2165 99.8 Minus
3R 32079331 3R 11453452..11453821 804..435 1850 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:53:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 11193680..11194130 1255..805 2255 100 Minus
3R 31820162 3R 11198416..11198851 436..1 2165 99.7 Minus
3R 31820162 3R 11194283..11194652 804..435 1850 100 Minus
Blast to na_te.dros performed on 2019-03-16 19:08:35 has no hits.

RE34140.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:09:33 Download gff for RE34140.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 7278321..7278771 805..1255 100 <- Minus
chr3R 7278924..7279292 436..804 100 <- Minus
chr3R 7283071..7283505 1..435 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:11:02 Download gff for RE34140.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-LB-RC 1..699 399..1097 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:41:52 Download gff for RE34140.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-LB-RC 1..699 399..1097 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:23:23 Download gff for RE34140.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-LB-RC 1..699 399..1097 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:30:39 Download gff for RE34140.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-LB-RC 1..699 399..1097 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:01:14 Download gff for RE34140.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-LB-RC 1..699 399..1097 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:51:19 Download gff for RE34140.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-LB-RC 1..1255 1..1255 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:41:52 Download gff for RE34140.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-LB-RC 1..1255 1..1255 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:23:23 Download gff for RE34140.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-LB-RC 1..1255 1..1255 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:30:40 Download gff for RE34140.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-LB-RC 1..1255 1..1255 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:01:14 Download gff for RE34140.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-LB-RC 1..1255 1..1255 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:09:33 Download gff for RE34140.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11452849..11453299 805..1255 100 <- Minus
3R 11453452..11453820 436..804 100 <- Minus
3R 11457586..11458020 1..435 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:09:33 Download gff for RE34140.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11452849..11453299 805..1255 100 <- Minus
3R 11453452..11453820 436..804 100 <- Minus
3R 11457586..11458020 1..435 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:09:33 Download gff for RE34140.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11452849..11453299 805..1255 100 <- Minus
3R 11453452..11453820 436..804 100 <- Minus
3R 11457586..11458020 1..435 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:23:23 Download gff for RE34140.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7278571..7279021 805..1255 100 <- Minus
arm_3R 7279174..7279542 436..804 100 <- Minus
arm_3R 7283308..7283742 1..435 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:03:12 Download gff for RE34140.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11193680..11194130 805..1255 100 <- Minus
3R 11194283..11194651 436..804 100 <- Minus
3R 11198417..11198851 1..435 99   Minus

RE34140.hyp Sequence

Translation from 398 to 1096

> RE34140.hyp
MTALGLVLLSMMGYSQHMQQANLGDGVATARLLSRSDWGARLPKSVEHFQ
GPAPYVIIHHSYMPAVCYSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIG
GDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKNL
IAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHINDTEG
VSSTTAPVVPHVHPQAAAPQKPHQSPPAAPKV*

RE34140.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:41:39
Subject Length Description Subject Range Query Range Score Percent Strand
PGRP-LB-PC 232 CG14704-PC 1..232 1..232 1260 100 Plus
PGRP-LB-PD 255 CG14704-PD 31..255 8..232 1208 98.2 Plus
PGRP-LB-PF 215 CG14704-PF 1..215 18..232 1176 100 Plus
PGRP-LB-PE 215 CG14704-PE 1..215 18..232 1176 100 Plus
PGRP-LB-PA 215 CG14704-PA 1..215 18..232 1176 100 Plus

RE34140.pep Sequence

Translation from 398 to 1096

> RE34140.pep
MTALGLVLLSMMGYSQHMQQANLGDGVATARLLSRSDWGARLPKSVEHFQ
GPAPYVIIHHSYMPAVCYSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIG
GDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKNL
IAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHINDTEG
VSSTTAPVVPHVHPQAAAPQKPHQSPPAAPKV*

RE34140.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:50:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16643-PA 226 GF16643-PA 1..225 1..231 1037 85.3 Plus
Dana\GF10506-PA 187 GF10506-PA 27..187 35..195 409 46 Plus
Dana\GF23927-PA 182 GF23927-PA 10..178 23..192 376 44 Plus
Dana\GF12377-PA 185 GF12377-PA 7..184 7..193 354 37.4 Plus
Dana\GF21644-PA 185 GF21644-PA 7..184 7..193 354 37.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:50:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17219-PA 306 GG17219-PA 79..294 1..220 1134 95 Plus
Dere\GG15854-PA 190 GG15854-PA 30..187 35..192 412 46.2 Plus
Dere\GG23381-PA 184 GG23381-PA 1..182 1..192 375 39.1 Plus
Dere\GG13574-PA 182 GG13574-PA 11..178 24..192 350 41.4 Plus
Dere\GG23380-PA 185 GG23380-PA 1..184 1..193 337 35.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:50:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15357-PA 218 GH15357-PA 1..203 1..199 830 78.3 Plus
Dgri\GH15225-PA 191 GH15225-PA 31..191 35..195 398 44.7 Plus
Dgri\GH21355-PA 184 GH21355-PA 23..182 32..192 388 43.5 Plus
Dgri\GH20540-PA 184 GH20540-PA 1..182 1..192 376 38 Plus
Dgri\GH21354-PA 184 GH21354-PA 23..182 32..192 374 42.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:38
Subject Length Description Subject Range Query Range Score Percent Strand
PGRP-LB-PC 232 CG14704-PC 1..232 1..232 1260 100 Plus
PGRP-LB-PD 255 CG14704-PD 31..255 8..232 1208 98.2 Plus
PGRP-LB-PF 215 CG14704-PF 1..215 18..232 1176 100 Plus
PGRP-LB-PE 215 CG14704-PE 1..215 18..232 1176 100 Plus
PGRP-LB-PA 215 CG14704-PA 1..215 18..232 1176 100 Plus
PGRP-LB-PB 215 CG14704-PB 1..215 18..232 1176 100 Plus
PGRP-SB1-PA 190 CG9681-PA 30..187 35..192 393 44.9 Plus
PGRP-SC2-PA 184 CG14745-PA 1..182 1..192 344 37 Plus
PGRP-SB2-PA 182 CG9697-PA 14..178 27..192 336 39.8 Plus
PGRP-SC1b-PB 185 CG8577-PB 7..184 7..193 330 36.4 Plus
PGRP-SC1b-PA 185 CG8577-PA 7..184 7..193 330 36.4 Plus
PGRP-SC1a-PA 185 CG14746-PA 7..184 7..193 330 36.4 Plus
PGRP-LE-PB 345 CG8995-PB 177..344 32..199 329 42.6 Plus
PGRP-LE-PA 345 CG8995-PA 177..344 32..199 329 42.6 Plus
PGRP-LF-PA 369 CG4437-PA 45..220 11..193 314 37.5 Plus
PGRP-SA-PB 203 CG11709-PB 13..199 3..192 306 36.3 Plus
PGRP-SA-PA 203 CG11709-PA 13..199 3..192 306 36.3 Plus
PGRP-LC-PE 329 CG4432-PE 135..327 4..194 304 35.9 Plus
PGRP-LC-PD 500 CG4432-PD 306..498 4..194 304 35.9 Plus
PGRP-LC-PA 500 CG4432-PA 306..498 4..194 304 35.9 Plus
PGRP-SD-PA 186 CG7496-PA 22..183 32..193 294 37.4 Plus
PGRP-LC-PJ 340 CG4432-PJ 135..332 4..198 270 33.2 Plus
PGRP-LC-PC 511 CG4432-PC 306..503 4..198 270 33.2 Plus
PGRP-LA-PF 299 CG32042-PF 102..273 17..192 214 31.8 Plus
PGRP-LA-PE 368 CG32042-PE 171..342 17..192 214 31.8 Plus
PGRP-SB2-PB 191 CG9697-PB 14..121 27..135 200 37.7 Plus
PGRP-LC-PK 330 CG4432-PK 135..330 4..193 192 28.8 Plus
PGRP-LC-PI 501 CG4432-PI 306..501 4..193 192 28.8 Plus
PGRP-LC-PH 520 CG4432-PH 346..520 22..193 184 29.4 Plus
PGRP-LC-PB 520 CG4432-PB 346..520 22..193 184 29.4 Plus
PGRP-LA-PG 138 CG32042-PG 1..112 77..192 175 34.5 Plus
PGRP-LA-PC 138 CG32042-PC 1..112 77..192 175 34.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:50:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22456-PA 212 GI22456-PA 1..205 1..201 856 78.6 Plus
Dmoj\GI11935-PA 191 GI11935-PA 31..191 35..195 415 45.3 Plus
Dmoj\GI20770-PA 184 GI20770-PA 16..182 25..192 408 44 Plus
Dmoj\GI18809-PA 184 GI18809-PA 16..182 25..192 370 39.3 Plus
Dmoj\GI18808-PA 187 GI18808-PA 26..185 32..192 348 40.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:50:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12268-PA 310 GL12268-PA 86..281 1..194 960 88.3 Plus
Dper\GL17120-PA 185 GL17120-PA 7..184 7..193 352 38 Plus
Dper\GL17117-PA 185 GL17117-PA 7..184 7..193 352 38 Plus
Dper\GL18052-PA 353 GL18052-PA 185..348 32..195 341 42.4 Plus
Dper\GL13286-PA 130 GL13286-PA 2..126 67..192 298 42.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:50:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13189-PA 225 GA13189-PA 1..196 1..194 942 88.3 Plus
Dpse\GA21961-PA 188 GA21961-PA 28..188 35..195 398 45.3 Plus
Dpse\GA13217-PA 184 GA13217-PA 1..182 1..192 382 39.6 Plus
Dpse\GA24974-PA 185 GA24974-PA 7..184 7..193 352 38 Plus
Dpse\GA21174-PA 185 GA21174-PA 7..184 7..193 352 38 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:50:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26096-PA 232 GM26096-PA 1..232 1..232 1196 95.3 Plus
Dsec\GM24370-PA 190 GM24370-PA 30..187 35..192 416 46.2 Plus
Dsec\GM25654-PA 182 GM25654-PA 11..178 24..192 343 39.7 Plus
Dsec\GM21060-PA 185 GM21060-PA 7..184 7..193 341 36.4 Plus
Dsec\GM21059-PA 185 GM21059-PA 7..184 7..193 341 36.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:50:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15111-PA 295 GD15111-PA 64..295 1..232 1240 97.4 Plus
Dsim\PGRP-SB1-PA 190 GD12445-PA 30..187 35..192 414 46.2 Plus
Dsim\PGRP-SC2-PA 184 GD10595-PA 1..182 1..192 370 38 Plus
Dsim\PGRP-SB2-PA 182 GD14659-PA 11..178 24..192 346 40 Plus
Dsim\PGRP-SC1a-PA 185 GD10593-PA 7..184 7..193 342 36.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:50:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10054-PA 214 GJ10054-PA 1..204 1..198 843 77.9 Plus
Dvir\GJ12160-PA 191 GJ12160-PA 31..191 35..195 404 44.7 Plus
Dvir\GJ20505-PA 184 GJ20505-PA 23..182 32..192 373 42.2 Plus
Dvir\GJ21836-PA 184 GJ21836-PA 23..182 32..192 365 39.8 Plus
Dvir\GJ18565-PA 366 GJ18565-PA 197..364 32..199 359 41.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:50:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11791-PA 212 GK11791-PA 1..209 1..208 922 82.3 Plus
Dwil\GK17343-PA 192 GK17343-PA 32..192 35..195 396 44.7 Plus
Dwil\GK17119-PA 173 GK17119-PA 1..169 23..192 377 45.3 Plus
Dwil\GK21737-PA 185 GK21737-PA 16..183 24..192 375 40.2 Plus
Dwil\GK21567-PA 187 GK21567-PA 9..185 7..192 351 37.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:50:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24618-PA 233 GE24618-PA 1..233 1..232 1150 91.4 Plus
Dyak\GE22193-PA 190 GE22193-PA 30..187 35..192 411 46.2 Plus
Dyak\GE19223-PA 184 GE19223-PA 1..182 1..192 372 38.5 Plus
Dyak\GE19221-PA 185 GE19221-PA 7..184 7..193 349 36.9 Plus
Dyak\GE19871-PA 184 GE19871-PA 14..180 25..192 348 40.5 Plus