Clone RE34324 Report

Search the DGRC for RE34324

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:343
Well:24
Vector:pFlc-1
Associated Gene/TranscriptCG5928-RB
Protein status:RE34324.pep: gold
Preliminary Size:552
Sequenced Size:876

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5928 2002-01-01 Sim4 clustering to Release 2
CG5928 2002-06-10 Blastp of sequenced clone
CG5928 2003-01-01 Sim4 clustering to Release 3
CG5928 2008-04-29 Release 5.5 accounting
CG5928 2008-08-15 Release 5.9 accounting
CG5928 2008-12-18 5.12 accounting

Clone Sequence Records

RE34324.complete Sequence

876 bp (876 high quality bases) assembled on 2002-06-10

GenBank Submission: AY071320

> RE34324.complete
ATTCAGTTGAATTTTGGACTCGAGAGACTTCGGATCGAAGCTCAACCTGG
GATTTGGATTTGGAAGTTTTCACCTTGTTATAAAACCACATAGTTGGGCC
CTTTCCCCCTTCTCCGCACATACTAACGAAAATGCTGCAACTTCAAAAGA
TGAATACTCTGCTGCTGCTCTTGGCCATGATGCGCTGCATCTGTGCCACG
CCCATAGCTCCTGCCACGCCCGATGGCGCCACGCCCATCGACGCCCGCGT
CTCGGCCGCCGACTTCGGAGCCCAGGATGCTTTCGATGCCGCCGACAGCT
CCGCGGAATCCACCCACGCGCAGGCCAGCGACGCCGGGTTCAAGGTGAGT
AACCGAGGTATACTTTAAAAATCCAAGTGACTTCCCCTTATTTTTCGGCA
GATCTCTCTCCTGCCCACTCCGGCTAAAACGGCGGAATCGGTGAATCTAG
AGCAGGAGGCCATTCCCTCGAAGGTGCTGAGCGTGTACGACAACAGTCAA
AAGAGGCTGGCCGATTTGGCGCAGCCCGTTCCCATTTTGGACTCCATCAG
TGAGCACGAGAAGTACGGCAACAACGGTGACATGTTCGACGGCATCTCGC
GATCCATTGTCAACGGCTACGAGGCCTTTTCCAACCTGCTCAACACCTTT
ATTCAGAAGCCCAAAGAGTTGGCGCGCAGCGTGACGAAGGGGATCACGGC
TCAATTGGATATCATAGGAGGCAAATTGGTGGGCCTTTGAGAAGGCGTGT
AATTTAAATAAATACTTTAATTTATTTTGTAACTTAACACGAACATGTTG
TTTAGGAATGCATTTCGATATAAATATTTGTATGTATGAATAAAATAATC
ATACGCATAGTAAAAAAAAAAAAAAA

RE34324.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:49:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG5928-RB 861 CG5928-RB 1..861 1..861 4305 100 Plus
CG5928-RA 878 CG5928-RA 417..878 400..861 2310 100 Plus
CG5928-RA 878 CG5928-RA 75..418 1..344 1720 100 Plus
Tsp5D-RB 1832 Tsp5D-RB 1696..1832 862..726 685 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:15:38
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 5960199..5960722 1..524 2575 99.4 Plus
chrX 22417052 chrX 5961293..5961499 654..861 990 99.5 Plus
chrX 22417052 chrX 5960788..5960922 522..656 675 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:51:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:15:35
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 6067960..6068483 1..524 2620 100 Plus
X 23542271 X 6069054..6069262 654..862 1045 100 Plus
X 23542271 X 6068549..6068683 522..656 675 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:22:08
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 6076058..6076581 1..524 2620 100 Plus
X 23527363 X 6077152..6077360 654..862 1045 100 Plus
X 23527363 X 6076647..6076781 522..656 675 100 Plus
Blast to na_te.dros performed 2019-03-15 20:15:36
Subject Length Description Subject Range Query Range Score Percent Strand
Quasimodo 7387 Quasimodo QUASIMODO 7387bp Derived from P1 clones DS08479 & DS07153 by Sue Celniker, 29 March 2001. 6507..6603 861..771 111 65 Minus
Tc3 1743 Tc3 TC3 1743bp 1628..1662 852..816 108 81.1 Minus

RE34324.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:16:28 Download gff for RE34324.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 5960199..5960722 1..524 99 -> Plus
chrX 5960791..5960922 525..656 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:11:08 Download gff for RE34324.complete
Subject Subject Range Query Range Percent Splice Strand
CG5928-RA 208..552 394..740 99   Plus
CG5928-RA 1..207 132..338 100 == Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:24:57 Download gff for RE34324.complete
Subject Subject Range Query Range Percent Splice Strand
CG5928-RA 1..207 132..338 100 == Plus
CG5928-RA 208..552 394..740 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:09:53 Download gff for RE34324.complete
Subject Subject Range Query Range Percent Splice Strand
CG5928-RA 1..207 132..338 100 == Plus
CG5928-RA 208..552 394..740 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:15:29 Download gff for RE34324.complete
Subject Subject Range Query Range Percent Splice Strand
CG5928-RA 1..207 132..338 100 == Plus
CG5928-RA 208..552 394..740 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:18:52 Download gff for RE34324.complete
Subject Subject Range Query Range Percent Splice Strand
CG5928-RA 208..552 394..740 99   Plus
CG5928-RA 1..207 132..338 100 == Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:52:36 Download gff for RE34324.complete
Subject Subject Range Query Range Percent Splice Strand
CG5928-RB 1..861 1..861 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:24:57 Download gff for RE34324.complete
Subject Subject Range Query Range Percent Splice Strand
CG5928-RB 1..861 1..861 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:09:53 Download gff for RE34324.complete
Subject Subject Range Query Range Percent Splice Strand
CG5928-RB 1..861 1..861 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:15:30 Download gff for RE34324.complete
Subject Subject Range Query Range Percent Splice Strand
CG5928-RB 1..861 1..861 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:18:52 Download gff for RE34324.complete
Subject Subject Range Query Range Percent Splice Strand
CG5928-RB 3..863 1..861 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:16:28 Download gff for RE34324.complete
Subject Subject Range Query Range Percent Splice Strand
X 6068552..6068683 525..656 100 -> Plus
X 6069057..6069261 657..861 100   Plus
X 6067960..6068483 1..524 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:16:28 Download gff for RE34324.complete
Subject Subject Range Query Range Percent Splice Strand
X 6068552..6068683 525..656 100 -> Plus
X 6069057..6069261 657..861 100   Plus
X 6067960..6068483 1..524 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:16:28 Download gff for RE34324.complete
Subject Subject Range Query Range Percent Splice Strand
X 6068552..6068683 525..656 100 -> Plus
X 6069057..6069261 657..861 100   Plus
X 6067960..6068483 1..524 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:09:53 Download gff for RE34324.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 5961993..5962516 1..524 100 -> Plus
arm_X 5962585..5962716 525..656 100 -> Plus
arm_X 5963090..5963294 657..861 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:48:37 Download gff for RE34324.complete
Subject Subject Range Query Range Percent Splice Strand
X 6077155..6077359 657..861 100   Plus
X 6076058..6076581 1..524 100 -> Plus
X 6076650..6076781 525..656 100 -> Plus

RE34324.pep Sequence

Translation from 131 to 367

> RE34324.pep
MLQLQKMNTLLLLLAMMRCICATPIAPATPDGATPIDARVSAADFGAQDA
FDAADSSAESTHAQASDAGFKVSNRGIL*

RE34324.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:49:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20369-PA 184 GF20369-PA 1..74 1..73 233 67.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:49:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19571-PA 183 GG19571-PA 1..73 1..73 322 84.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:49:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24849-PA 186 GH24849-PA 17..76 15..73 168 60.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG5928-PB 78 CG5928-PB 1..78 1..78 389 100 Plus
CG5928-PA 183 CG5928-PA 1..73 1..73 363 98.6 Plus
CG5928-PC 199 CG5928-PC 1..73 1..73 363 98.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:49:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16185-PA 319 GI16185-PA 19..67 24..73 135 64 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:49:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14908-PA 186 GL14908-PA 23..75 18..72 160 61.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:49:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19236-PA 186 GA19236-PA 23..75 18..72 160 61.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:49:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12464-PA 183 GM12464-PA 1..73 1..73 334 87.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:49:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16782-PA 183 GD16782-PA 1..73 1..73 332 89 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:49:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16674-PA 181 GJ16674-PA 21..71 22..73 133 71.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:49:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15823-PA 192 GK15823-PA 15..82 10..73 160 58.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:49:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16731-PA 186 GE16731-PA 1..76 1..73 262 84.2 Plus

RE34324.hyp Sequence

Translation from 131 to 367

> RE34324.hyp
MLQLQKMNTLLLLLAMMRCICATPIAPATPDGATPIDARVSAADFGAQDA
FDAADSSAESTHAQASDAGFKVSNRGIL*

RE34324.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:37:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG5928-PB 78 CG5928-PB 1..78 1..78 389 100 Plus
CG5928-PA 183 CG5928-PA 1..73 1..73 363 98.6 Plus
CG5928-PC 199 CG5928-PC 1..73 1..73 363 98.6 Plus