BDGP Sequence Production Resources |
Search the DGRC for RE34379
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 343 |
Well: | 79 |
Vector: | pFlc-1 |
Associated Gene/Transcript | RpS14a-RA |
Protein status: | RE34379.pep: gold |
Sequenced Size: | 603 |
Gene | Date | Evidence |
---|---|---|
CG1527 | 2002-01-01 | Sim4 clustering to Release 2 |
CG1527 | 2003-01-01 | Sim4 clustering to Release 3 |
RpS14b | 2008-04-29 | Release 5.5 accounting |
RpS14b | 2008-08-15 | Release 5.9 accounting |
RpS14b | 2008-12-18 | 5.12 accounting |
603 bp (603 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071321
> RE34379.complete CTTTTTTTCGCATCCGGCGCACGCAATTGTTGCTGATCGACGACCAGACT CTGCAGAATGGCTCCAAGAAAGGCTAAAGTTCAGAAGGAGGAGGTTCAGG TCCAGCTGGGACCCCAAGTTCGCGACGGCGAGATCGTGTTCGGAGTGGCT CACATCTACGCCAGCTTCAACGACACCTTCGTCCATGTCACGGATCTGTC CGGCCGTGAGACCATCGCTCGTGTCACCGGAGGCATGAAGGTGAAGGCCG ATCGTGATGAGGCTTCGCCCTACGCCGCTATGTTGGCCGCTCAGGATGTG GCTGAGAAGTGCAAGACACTGGGCATCACTGCCCTGCATATTAAGCTGCG TGCCACCGGCGGCAACAAGACCAAGACCCCCGGACCCGGCGCCCAGTCCG CTCTGCGTGCGTTGGCCCGTTCGTCCATGAAGATTGGCCGCATCGAGGAT GTGACCCCTATCCCATCGGACTCTACCCGCAGGAAGGGCGGTCGCCGAGG TCGTCGTCTGTAGAAATGGATCGTGCCACCCGCTTTTGACGCTGCTTTAT ATTCTTATACTATTAAATACATGCATAAATGCAGTGGCAAAAAAAAAAAA AAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 7827390..7827686 | 292..588 | 1485 | 100 | Plus |
chrX | 22417052 | chrX | 7827068..7827334 | 29..295 | 1335 | 100 | Plus |
chrX | 22417052 | chrX | 7825924..7826165 | 54..295 | 1150 | 98.3 | Plus |
chrX | 22417052 | chrX | 7826221..7826443 | 292..514 | 1040 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23542271 | X | 7935496..7935794 | 292..590 | 1495 | 100 | Plus |
X | 23542271 | X | 7935174..7935440 | 29..295 | 1335 | 100 | Plus |
X | 23542271 | X | 7934030..7934271 | 54..295 | 1150 | 98.3 | Plus |
X | 23542271 | X | 7934327..7934549 | 292..514 | 1025 | 97.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23527363 | X | 7943594..7943892 | 292..590 | 1495 | 100 | Plus |
X | 23527363 | X | 7943272..7943538 | 29..295 | 1335 | 100 | Plus |
X | 23527363 | X | 7942128..7942369 | 54..295 | 1150 | 98.3 | Plus |
X | 23527363 | X | 7942425..7942647 | 292..514 | 1025 | 97.3 | Plus |
X | 23527363 | X | 7943002..7943030 | 1..29 | 145 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 7826798..7826826 | 1..29 | 100 | -> | Plus |
chrX | 7827069..7827333 | 30..294 | 100 | -> | Plus |
chrX | 7827393..7827686 | 295..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS14b-RA | 1..456 | 58..513 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS14b-RA | 1..456 | 58..513 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS14b-RA | 1..456 | 58..513 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS14b-RA | 1..456 | 58..513 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS14b-RA | 1..456 | 58..513 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS14b-RA | 1..588 | 1..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS14b-RA | 1..588 | 1..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS14b-RA | 7..594 | 1..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS14b-RA | 1..588 | 1..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS14b-RA | 7..594 | 1..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 7934904..7934932 | 1..29 | 100 | -> | Plus |
X | 7935175..7935439 | 30..294 | 100 | -> | Plus |
X | 7935499..7935792 | 295..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 7934904..7934932 | 1..29 | 100 | -> | Plus |
X | 7935175..7935439 | 30..294 | 100 | -> | Plus |
X | 7935499..7935792 | 295..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 7934904..7934932 | 1..29 | 100 | -> | Plus |
X | 7935175..7935439 | 30..294 | 100 | -> | Plus |
X | 7935499..7935792 | 295..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 7828937..7828965 | 1..29 | 100 | -> | Plus |
arm_X | 7829208..7829472 | 30..294 | 100 | -> | Plus |
arm_X | 7829532..7829825 | 295..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 7943273..7943537 | 30..294 | 100 | -> | Plus |
X | 7943597..7943890 | 295..588 | 100 | Plus | |
X | 7943002..7943030 | 1..29 | 100 | -> | Plus |
Translation from 57 to 512
> RE34379.pep MAPRKAKVQKEEVQVQLGPQVRDGEIVFGVAHIYASFNDTFVHVTDLSGR ETIARVTGGMKVKADRDEASPYAAMLAAQDVAEKCKTLGITALHIKLRAT GGNKTKTPGPGAQSALRALARSSMKIGRIEDVTPIPSDSTRRKGGRRGRR L*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF21290-PA | 151 | GF21290-PA | 1..151 | 1..151 | 784 | 100 | Plus |
Dana\GF21291-PA | 151 | GF21291-PA | 1..151 | 1..151 | 778 | 99.3 | Plus |
Dana\GF13166-PA | 122 | GF13166-PA | 1..81 | 60..140 | 391 | 93.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG19671-PA | 151 | GG19671-PA | 1..151 | 1..151 | 783 | 99.3 | Plus |
Dere\GG19672-PA | 151 | GG19672-PA | 1..151 | 1..151 | 777 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH24437-PA | 151 | GH24437-PA | 1..151 | 1..151 | 771 | 98.7 | Plus |
Dgri\GH24178-PA | 151 | GH24178-PA | 1..151 | 1..151 | 763 | 97.4 | Plus |
Dgri\GH17341-PA | 151 | GH17341-PA | 1..140 | 1..140 | 700 | 95 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS14b-PB | 151 | CG1527-PB | 1..151 | 1..151 | 759 | 100 | Plus |
RpS14b-PA | 151 | CG1527-PA | 1..151 | 1..151 | 759 | 100 | Plus |
RpS14a-PA | 151 | CG1524-PA | 1..151 | 1..151 | 759 | 100 | Plus |
RpS14a-PB | 151 | CG1524-PB | 1..151 | 1..151 | 759 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI21595-PA | 151 | GI21595-PA | 1..151 | 1..151 | 778 | 99.3 | Plus |
Dmoj\GI15807-PA | 151 | GI15807-PA | 1..151 | 1..151 | 763 | 97.4 | Plus |
Dmoj\GI18903-PA | 151 | GI18903-PA | 1..140 | 1..140 | 691 | 94.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL15135-PA | 151 | GL15135-PA | 1..151 | 1..151 | 779 | 99.3 | Plus |
Dper\GL23180-PA | 151 | GL23180-PA | 1..151 | 1..151 | 767 | 98 | Plus |
Dper\GL15136-PA | 151 | GL15136-PA | 1..151 | 1..151 | 767 | 98 | Plus |
Dper\GL18171-PA | 151 | GL18171-PA | 1..140 | 1..140 | 694 | 95.7 | Plus |
Dper\GL16027-PA | 151 | GL16027-PA | 1..138 | 1..138 | 620 | 84.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA22775-PA | 151 | GA22775-PA | 1..151 | 1..151 | 779 | 99.3 | Plus |
Dpse\GA22776-PA | 151 | GA22776-PA | 1..151 | 1..151 | 767 | 98 | Plus |
Dpse\GA22514-PA | 151 | GA22514-PA | 1..140 | 1..140 | 689 | 95 | Plus |
Dpse\GA26109-PA | 151 | GA26109-PA | 1..138 | 1..138 | 629 | 86.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM11985-PA | 151 | GM11985-PA | 1..151 | 1..151 | 779 | 99.3 | Plus |
Dsec\GM11986-PA | 151 | GM11986-PA | 1..151 | 1..151 | 745 | 96 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD24764-PA | 151 | GD24764-PA | 1..151 | 1..151 | 777 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ16536-PA | 151 | GJ16536-PA | 1..151 | 1..151 | 781 | 99.3 | Plus |
Dvir\GJ18661-PA | 151 | GJ18661-PA | 1..151 | 1..151 | 763 | 97.4 | Plus |
Dvir\GJ20727-PA | 151 | GJ20727-PA | 1..140 | 1..140 | 704 | 95.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK16382-PA | 151 | GK16382-PA | 1..151 | 1..151 | 770 | 98 | Plus |
Dwil\GK16381-PA | 151 | GK16381-PA | 1..151 | 1..151 | 770 | 98 | Plus |
Dwil\GK23091-PA | 151 | GK23091-PA | 1..151 | 1..151 | 764 | 97.4 | Plus |
Translation from 57 to 512
> RE34379.hyp MAPRKAKVQKEEVQVQLGPQVRDGEIVFGVAHIYASFNDTFVHVTDLSGR ETIARVTGGMKVKADRDEASPYAAMLAAQDVAEKCKTLGITALHIKLRAT GGNKTKTPGPGAQSALRALARSSMKIGRIEDVTPIPSDSTRRKGGRRGRR L*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS14b-PB | 151 | CG1527-PB | 1..151 | 1..151 | 759 | 100 | Plus |
RpS14b-PA | 151 | CG1527-PA | 1..151 | 1..151 | 759 | 100 | Plus |
RpS14a-PA | 151 | CG1524-PA | 1..151 | 1..151 | 759 | 100 | Plus |
RpS14a-PB | 151 | CG1524-PB | 1..151 | 1..151 | 759 | 100 | Plus |