Clone RE34379 Report

Search the DGRC for RE34379

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:343
Well:79
Vector:pFlc-1
Associated Gene/TranscriptRpS14a-RA
Protein status:RE34379.pep: gold
Sequenced Size:603

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1527 2002-01-01 Sim4 clustering to Release 2
CG1527 2003-01-01 Sim4 clustering to Release 3
RpS14b 2008-04-29 Release 5.5 accounting
RpS14b 2008-08-15 Release 5.9 accounting
RpS14b 2008-12-18 5.12 accounting

Clone Sequence Records

RE34379.complete Sequence

603 bp (603 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071321

> RE34379.complete
CTTTTTTTCGCATCCGGCGCACGCAATTGTTGCTGATCGACGACCAGACT
CTGCAGAATGGCTCCAAGAAAGGCTAAAGTTCAGAAGGAGGAGGTTCAGG
TCCAGCTGGGACCCCAAGTTCGCGACGGCGAGATCGTGTTCGGAGTGGCT
CACATCTACGCCAGCTTCAACGACACCTTCGTCCATGTCACGGATCTGTC
CGGCCGTGAGACCATCGCTCGTGTCACCGGAGGCATGAAGGTGAAGGCCG
ATCGTGATGAGGCTTCGCCCTACGCCGCTATGTTGGCCGCTCAGGATGTG
GCTGAGAAGTGCAAGACACTGGGCATCACTGCCCTGCATATTAAGCTGCG
TGCCACCGGCGGCAACAAGACCAAGACCCCCGGACCCGGCGCCCAGTCCG
CTCTGCGTGCGTTGGCCCGTTCGTCCATGAAGATTGGCCGCATCGAGGAT
GTGACCCCTATCCCATCGGACTCTACCCGCAGGAAGGGCGGTCGCCGAGG
TCGTCGTCTGTAGAAATGGATCGTGCCACCCGCTTTTGACGCTGCTTTAT
ATTCTTATACTATTAAATACATGCATAAATGCAGTGGCAAAAAAAAAAAA
AAA

RE34379.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:44:37
Subject Length Description Subject Range Query Range Score Percent Strand
RpS14b-RA 799 RpS14b-RA 56..645 1..590 2950 100 Plus
RpS14a-RB 910 RpS14a-RB 247..707 54..514 2155 97.8 Plus
RpS14a-RA 980 RpS14a-RA 317..777 54..514 2155 97.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:56:13
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 7827390..7827686 292..588 1485 100 Plus
chrX 22417052 chrX 7827068..7827334 29..295 1335 100 Plus
chrX 22417052 chrX 7825924..7826165 54..295 1150 98.3 Plus
chrX 22417052 chrX 7826221..7826443 292..514 1040 97.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:51:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:56:11
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7935496..7935794 292..590 1495 100 Plus
X 23542271 X 7935174..7935440 29..295 1335 100 Plus
X 23542271 X 7934030..7934271 54..295 1150 98.3 Plus
X 23542271 X 7934327..7934549 292..514 1025 97.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:11:18
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 7943594..7943892 292..590 1495 100 Plus
X 23527363 X 7943272..7943538 29..295 1335 100 Plus
X 23527363 X 7942128..7942369 54..295 1150 98.3 Plus
X 23527363 X 7942425..7942647 292..514 1025 97.3 Plus
X 23527363 X 7943002..7943030 1..29 145 100 Plus
Blast to na_te.dros performed on 2019-03-16 01:56:12 has no hits.

RE34379.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:56:49 Download gff for RE34379.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 7826798..7826826 1..29 100 -> Plus
chrX 7827069..7827333 30..294 100 -> Plus
chrX 7827393..7827686 295..588 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:11:09 Download gff for RE34379.complete
Subject Subject Range Query Range Percent Splice Strand
RpS14b-RA 1..456 58..513 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:11:18 Download gff for RE34379.complete
Subject Subject Range Query Range Percent Splice Strand
RpS14b-RA 1..456 58..513 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:12:06 Download gff for RE34379.complete
Subject Subject Range Query Range Percent Splice Strand
RpS14b-RA 1..456 58..513 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:35:33 Download gff for RE34379.complete
Subject Subject Range Query Range Percent Splice Strand
RpS14b-RA 1..456 58..513 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:51:57 Download gff for RE34379.complete
Subject Subject Range Query Range Percent Splice Strand
RpS14b-RA 1..456 58..513 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:41:31 Download gff for RE34379.complete
Subject Subject Range Query Range Percent Splice Strand
RpS14b-RA 1..588 1..588 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:11:18 Download gff for RE34379.complete
Subject Subject Range Query Range Percent Splice Strand
RpS14b-RA 1..588 1..588 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:12:06 Download gff for RE34379.complete
Subject Subject Range Query Range Percent Splice Strand
RpS14b-RA 7..594 1..588 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:35:33 Download gff for RE34379.complete
Subject Subject Range Query Range Percent Splice Strand
RpS14b-RA 1..588 1..588 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:51:57 Download gff for RE34379.complete
Subject Subject Range Query Range Percent Splice Strand
RpS14b-RA 7..594 1..588 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:56:49 Download gff for RE34379.complete
Subject Subject Range Query Range Percent Splice Strand
X 7934904..7934932 1..29 100 -> Plus
X 7935175..7935439 30..294 100 -> Plus
X 7935499..7935792 295..588 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:56:49 Download gff for RE34379.complete
Subject Subject Range Query Range Percent Splice Strand
X 7934904..7934932 1..29 100 -> Plus
X 7935175..7935439 30..294 100 -> Plus
X 7935499..7935792 295..588 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:56:49 Download gff for RE34379.complete
Subject Subject Range Query Range Percent Splice Strand
X 7934904..7934932 1..29 100 -> Plus
X 7935175..7935439 30..294 100 -> Plus
X 7935499..7935792 295..588 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:12:06 Download gff for RE34379.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7828937..7828965 1..29 100 -> Plus
arm_X 7829208..7829472 30..294 100 -> Plus
arm_X 7829532..7829825 295..588 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:12:49 Download gff for RE34379.complete
Subject Subject Range Query Range Percent Splice Strand
X 7943273..7943537 30..294 100 -> Plus
X 7943597..7943890 295..588 100   Plus
X 7943002..7943030 1..29 100 -> Plus

RE34379.pep Sequence

Translation from 57 to 512

> RE34379.pep
MAPRKAKVQKEEVQVQLGPQVRDGEIVFGVAHIYASFNDTFVHVTDLSGR
ETIARVTGGMKVKADRDEASPYAAMLAAQDVAEKCKTLGITALHIKLRAT
GGNKTKTPGPGAQSALRALARSSMKIGRIEDVTPIPSDSTRRKGGRRGRR
L*

RE34379.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:15:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21290-PA 151 GF21290-PA 1..151 1..151 784 100 Plus
Dana\GF21291-PA 151 GF21291-PA 1..151 1..151 778 99.3 Plus
Dana\GF13166-PA 122 GF13166-PA 1..81 60..140 391 93.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:15:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19671-PA 151 GG19671-PA 1..151 1..151 783 99.3 Plus
Dere\GG19672-PA 151 GG19672-PA 1..151 1..151 777 98.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:15:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24437-PA 151 GH24437-PA 1..151 1..151 771 98.7 Plus
Dgri\GH24178-PA 151 GH24178-PA 1..151 1..151 763 97.4 Plus
Dgri\GH17341-PA 151 GH17341-PA 1..140 1..140 700 95 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:41
Subject Length Description Subject Range Query Range Score Percent Strand
RpS14b-PB 151 CG1527-PB 1..151 1..151 759 100 Plus
RpS14b-PA 151 CG1527-PA 1..151 1..151 759 100 Plus
RpS14a-PA 151 CG1524-PA 1..151 1..151 759 100 Plus
RpS14a-PB 151 CG1524-PB 1..151 1..151 759 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:15:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21595-PA 151 GI21595-PA 1..151 1..151 778 99.3 Plus
Dmoj\GI15807-PA 151 GI15807-PA 1..151 1..151 763 97.4 Plus
Dmoj\GI18903-PA 151 GI18903-PA 1..140 1..140 691 94.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:15:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15135-PA 151 GL15135-PA 1..151 1..151 779 99.3 Plus
Dper\GL23180-PA 151 GL23180-PA 1..151 1..151 767 98 Plus
Dper\GL15136-PA 151 GL15136-PA 1..151 1..151 767 98 Plus
Dper\GL18171-PA 151 GL18171-PA 1..140 1..140 694 95.7 Plus
Dper\GL16027-PA 151 GL16027-PA 1..138 1..138 620 84.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:15:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22775-PA 151 GA22775-PA 1..151 1..151 779 99.3 Plus
Dpse\GA22776-PA 151 GA22776-PA 1..151 1..151 767 98 Plus
Dpse\GA22514-PA 151 GA22514-PA 1..140 1..140 689 95 Plus
Dpse\GA26109-PA 151 GA26109-PA 1..138 1..138 629 86.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:15:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11985-PA 151 GM11985-PA 1..151 1..151 779 99.3 Plus
Dsec\GM11986-PA 151 GM11986-PA 1..151 1..151 745 96 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:15:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24764-PA 151 GD24764-PA 1..151 1..151 777 98.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:15:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16536-PA 151 GJ16536-PA 1..151 1..151 781 99.3 Plus
Dvir\GJ18661-PA 151 GJ18661-PA 1..151 1..151 763 97.4 Plus
Dvir\GJ20727-PA 151 GJ20727-PA 1..140 1..140 704 95.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:15:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16382-PA 151 GK16382-PA 1..151 1..151 770 98 Plus
Dwil\GK16381-PA 151 GK16381-PA 1..151 1..151 770 98 Plus
Dwil\GK23091-PA 151 GK23091-PA 1..151 1..151 764 97.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:15:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\RpS14a-PA 151 GE15748-PA 1..151 1..151 784 100 Plus
Dyak\GE15749-PA 151 GE15749-PA 1..151 1..151 770 98 Plus

RE34379.hyp Sequence

Translation from 57 to 512

> RE34379.hyp
MAPRKAKVQKEEVQVQLGPQVRDGEIVFGVAHIYASFNDTFVHVTDLSGR
ETIARVTGGMKVKADRDEASPYAAMLAAQDVAEKCKTLGITALHIKLRAT
GGNKTKTPGPGAQSALRALARSSMKIGRIEDVTPIPSDSTRRKGGRRGRR
L*

RE34379.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:04:39
Subject Length Description Subject Range Query Range Score Percent Strand
RpS14b-PB 151 CG1527-PB 1..151 1..151 759 100 Plus
RpS14b-PA 151 CG1527-PA 1..151 1..151 759 100 Plus
RpS14a-PA 151 CG1524-PA 1..151 1..151 759 100 Plus
RpS14a-PB 151 CG1524-PB 1..151 1..151 759 100 Plus