Clone RE34668 Report

Search the DGRC for RE34668

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:346
Well:68
Vector:pFlc-1
Associated Gene/TranscriptCG15611-RB
Protein status:RE34668.pep: gold
Preliminary Size:1742
Sequenced Size:1640

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15611 2002-01-01 Sim4 clustering to Release 2
CG15611 2002-05-17 Blastp of sequenced clone
CG15611 2003-01-01 Sim4 clustering to Release 3
CG15611 2008-04-29 Release 5.5 accounting
CG15611 2008-08-15 Release 5.9 accounting
CG15611 2008-12-18 5.12 accounting

Clone Sequence Records

RE34668.complete Sequence

1640 bp (1640 high quality bases) assembled on 2002-05-17

GenBank Submission: AY119130

> RE34668.complete
AGTGGAGTTTCGCGTTTGATTCGCTACGGATCGGTATCGTAATACTGTTA
CTGGCCATATATAGTACACGTTTTGCCATCGATATGCGTCGAATTCGGCG
GTGGTTTAGTCTATAGTGAGCTGTGAAAAAAAACCAAATCAACCAATATG
GAGTTGTCATTGTTCACATTAAATTTGTTCGATGTGGTCTCGGTGGTGCT
CACATTTCTTGTGATATTTCTAGTGCAAATTCTTAACGTTTACTTGCATA
TACTCGACGATAATGCCGATAATGGCAAATCGATCGATGTGGTGGACAAG
GCACCAGCGAAAGAATGCCCGTTACTTGAGTCCCAGTCACCCAGTTCACC
AATCGCCACCACTCTACCGAAATCCCAGGCATCGAGCAACGGCAAGTTGG
AGAAGCAAATAAGTCTGCTGGACAGCGATAGCCACGAGGATGAGGACACA
TTGTCCTTGGAAAATCTGTTTCCCTGCGATCAAACCGAGATCTATGCCTC
CAAGAAGATCAGCTTCATAATCGACGAGCTCATCCAGACGGAGGTGAACT
ATGTGAACAATCTGAAGAAGGGTATGCTAAACTATGGACAGCTGAAGGAT
GTCGAGGATTTGCCAGAAGCCCTGAGTGGCGAAACGAAACAAAAGATGCT
GCTGGGAAACATTAAGGAAATACTGGAGCTGCATGAGAAGGAGATACTGC
CGCTCATGTTGCGCAATCAGCGGGATCTCAAAGGTCTATTCGATGAGTTT
GCTGCTCACTTCGAGAAAAATAGCTTCTATTGCTATGTGAGCTTCACTAT
GGGGAAGAAGTCTTCTATGCAACTGCGACAGGATAATCGGCTGTGGTTGC
AGACATATCAAACCCAAATAAAAGACAAGCTGGGCATCGACAGCTTCCTA
GTTCAGCCCATCCAAAGACTGACCAGATATCCATTGCTCCTGCAGCAGTT
CATATCGGAATTCTACAAAAGTGGAATTAGTTGCAAGCCAGTGCTGACTG
CAGTTTGCAAACTCGAGACGCGCATGCGACGCGCTCTGGATGTGGTCAAT
CAGGCCGAGGAGATACCCAACATCGAGGAGCTCAACGAGTTGGACGTCCT
GCAGCTGGGAAACTTCCGCCGTGCGACGGAATTCGACGCCCAGCACTTTC
CCACCCGGAAAAAGTACCGCTCCAAGGTGTTCCTGTTCGATCGCTGTTTG
GTGTGCACGGAGGTGCGAAAGAAGCGGCTGGCCTACCGGCAGCACTACAA
CTGGGAGCACGTGGAGCTGCAGAGGCCACTGGACTCGGTCTCGTCCAATG
CCAACAAGATCATTAACCTGCTAGTGAAACAGGAGGAGGGCGGATCTAGT
GTCGGCTCCAAGCGGGAGGAGTACTCCTTTATGGCTGCGGAGGCGTCGGT
GGTGAAGCAGTGGCTCCAGGCCACCCACAAGATCATCGAGATCGCACGCA
ATGAGCACGCCAGGCGGAACACCTTTAGCCTGCCCATGGACCTGGTCCTC
GGCGTGGTGCTGGCCATCTGGCTGATCTGGCAGTACTTGTAAATAGTTCC
CACCTCAATGCAACAACCATGTCCACATGCCCATCTAGATCGTAGATATC
TAAGAATAAAGCTAAGTTATTTCGTAAAAAAAAAAAAAAA

RE34668.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:05:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG15611-RB 1893 CG15611-RB 101..1725 1..1626 8075 99.8 Plus
CG15611-RA 2044 CG15611-RA 663..1857 432..1626 5975 100 Plus
CG15611.a 1651 CG15611.a 457..1651 432..1626 5975 100 Plus
CG15611-RA 2044 CG15611-RA 101..531 1..432 2105 99.5 Plus
CG15611.a 1651 CG15611.a 117..325 224..432 1045 100 Plus
CG15611.a 1651 CG15611.a 2..116 1..115 560 99.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:26:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13001014..13001551 1088..1625 2600 98.9 Plus
chr2R 21145070 chr2R 12996044..12996467 1..431 1965 98.1 Plus
chr2R 21145070 chr2R 12997356..12997691 430..765 1680 100 Plus
chr2R 21145070 chr2R 13000819..13000951 957..1089 665 100 Plus
chr2R 21145070 chr2R 13000657..13000764 851..958 540 100 Plus
chr2R 21145070 chr2R 13000507..13000595 764..852 445 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:51:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:26:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17113823..17114361 1088..1626 2695 100 Plus
2R 25286936 2R 17108847..17109276 1..431 2090 99.5 Plus
2R 25286936 2R 17110165..17110500 430..765 1680 100 Plus
2R 25286936 2R 17113628..17113760 957..1089 665 100 Plus
2R 25286936 2R 17113466..17113573 851..958 540 100 Plus
2R 25286936 2R 17113316..17113404 764..852 445 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:37:01
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17115022..17115560 1088..1626 2695 100 Plus
2R 25260384 2R 17110046..17110475 1..431 2100 99.5 Plus
2R 25260384 2R 17111364..17111699 430..765 1680 100 Plus
2R 25260384 2R 17114827..17114959 957..1089 665 100 Plus
2R 25260384 2R 17114665..17114772 851..958 540 100 Plus
2R 25260384 2R 17114515..17114603 764..852 445 100 Plus
Blast to na_te.dros performed on 2019-03-16 03:26:17 has no hits.

RE34668.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:27:12 Download gff for RE34668.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12996044..12996467 1..431 98 -> Plus
chr2R 12997358..12997691 432..765 100 -> Plus
chr2R 13000509..13000595 766..852 100 -> Plus
chr2R 13000659..13000763 853..957 100 -> Plus
chr2R 13000820..13000951 958..1089 100 -> Plus
chr2R 13001016..13001551 1090..1625 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:11:18 Download gff for RE34668.complete
Subject Subject Range Query Range Percent Splice Strand
CG15611-RB 1..1395 148..1542 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:48:07 Download gff for RE34668.complete
Subject Subject Range Query Range Percent Splice Strand
CG15611-RB 1..1395 148..1542 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:45:25 Download gff for RE34668.complete
Subject Subject Range Query Range Percent Splice Strand
CG15611-RB 1..1395 148..1542 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:40:33 Download gff for RE34668.complete
Subject Subject Range Query Range Percent Splice Strand
CG15611-RB 1..1395 148..1542 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:37:51 Download gff for RE34668.complete
Subject Subject Range Query Range Percent Splice Strand
CG15611-RB 1..1395 148..1542 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:24:31 Download gff for RE34668.complete
Subject Subject Range Query Range Percent Splice Strand
CG15611-RB 1..1624 1..1625 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:48:07 Download gff for RE34668.complete
Subject Subject Range Query Range Percent Splice Strand
CG15611-RB 1..1624 1..1625 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:45:25 Download gff for RE34668.complete
Subject Subject Range Query Range Percent Splice Strand
CG15611-RB 4..1627 1..1625 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:40:33 Download gff for RE34668.complete
Subject Subject Range Query Range Percent Splice Strand
CG15611-RB 1..1624 1..1625 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:37:51 Download gff for RE34668.complete
Subject Subject Range Query Range Percent Splice Strand
CG15611-RB 4..1627 1..1625 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:27:12 Download gff for RE34668.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17108847..17109276 1..431 99 -> Plus
2R 17110167..17110500 432..765 100 -> Plus
2R 17113318..17113404 766..852 100 -> Plus
2R 17113468..17113572 853..957 100 -> Plus
2R 17113629..17113760 958..1089 100 -> Plus
2R 17113825..17114360 1090..1625 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:27:12 Download gff for RE34668.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17108847..17109276 1..431 99 -> Plus
2R 17110167..17110500 432..765 100 -> Plus
2R 17113318..17113404 766..852 100 -> Plus
2R 17113468..17113572 853..957 100 -> Plus
2R 17113629..17113760 958..1089 100 -> Plus
2R 17113825..17114360 1090..1625 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:27:12 Download gff for RE34668.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17108847..17109276 1..431 99 -> Plus
2R 17110167..17110500 432..765 100 -> Plus
2R 17113318..17113404 766..852 100 -> Plus
2R 17113468..17113572 853..957 100 -> Plus
2R 17113629..17113760 958..1089 100 -> Plus
2R 17113825..17114360 1090..1625 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:45:25 Download gff for RE34668.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13000823..13000909 766..852 100 -> Plus
arm_2R 13000973..13001077 853..957 100 -> Plus
arm_2R 13001134..13001265 958..1089 100 -> Plus
arm_2R 12996352..12996781 1..431 99 -> Plus
arm_2R 12997672..12998005 432..765 100 -> Plus
arm_2R 13001330..13001865 1090..1625 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:12:54 Download gff for RE34668.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17110046..17110475 1..431 99 -> Plus
2R 17111366..17111699 432..765 100 -> Plus
2R 17114517..17114603 766..852 100 -> Plus
2R 17114667..17114771 853..957 100 -> Plus
2R 17114828..17114959 958..1089 100 -> Plus
2R 17115024..17115559 1090..1625 100   Plus

RE34668.pep Sequence

Translation from 147 to 1541

> RE34668.pep
MELSLFTLNLFDVVSVVLTFLVIFLVQILNVYLHILDDNADNGKSIDVVD
KAPAKECPLLESQSPSSPIATTLPKSQASSNGKLEKQISLLDSDSHEDED
TLSLENLFPCDQTEIYASKKISFIIDELIQTEVNYVNNLKKGMLNYGQLK
DVEDLPEALSGETKQKMLLGNIKEILELHEKEILPLMLRNQRDLKGLFDE
FAAHFEKNSFYCYVSFTMGKKSSMQLRQDNRLWLQTYQTQIKDKLGIDSF
LVQPIQRLTRYPLLLQQFISEFYKSGISCKPVLTAVCKLETRMRRALDVV
NQAEEIPNIEELNELDVLQLGNFRRATEFDAQHFPTRKKYRSKVFLFDRC
LVCTEVRKKRLAYRQHYNWEHVELQRPLDSVSSNANKIINLLVKQEEGGS
SVGSKREEYSFMAAEASVVKQWLQATHKIIEIARNEHARRNTFSLPMDLV
LGVVLAIWLIWQYL*

RE34668.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:18:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11439-PA 515 GF11439-PA 1..515 1..464 1995 74.4 Plus
Dana\GF11438-PA 683 GF11438-PA 327..574 124..372 554 44.8 Plus
Dana\GF10654-PA 1850 GF10654-PA 1297..1536 119..358 201 28.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:18:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20662-PA 508 GG20662-PA 1..508 1..464 2250 84.3 Plus
Dere\GG20661-PA 585 GG20661-PA 222..476 117..372 559 44.7 Plus
Dere\GG14443-PA 1898 GG14443-PA 1344..1583 119..358 198 29 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:18:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21011-PA 513 GH21011-PA 1..513 5..464 1799 68.5 Plus
Dgri\GH21010-PA 602 GH21010-PA 231..532 117..436 568 39.6 Plus
Dgri\GH14899-PA 1957 GH14899-PA 1406..1645 119..358 195 28.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG15611-PB 464 CG15611-PB 1..464 1..464 2367 100 Plus
CG15611-PA 508 CG15611-PA 1..508 1..464 2312 91.3 Plus
CG30456-PC 443 CG30456-PC 80..334 117..372 555 44.4 Plus
CG30456-PD 592 CG30456-PD 229..483 117..372 555 44.4 Plus
CG30456-PB 682 CG30456-PB 319..573 117..372 555 44.4 Plus
Pura-PC 872 CG33275-PC 316..555 119..358 207 28.2 Plus
Pura-PB 1428 CG33275-PB 872..1111 119..358 207 28.2 Plus
Pura-PD 1898 CG33275-PD 1342..1581 119..358 207 28.2 Plus
Pura-PA 1904 CG33275-PA 1348..1587 119..358 207 28.2 Plus
trio-PC 2263 CG18214-PC 1246..1521 88..365 161 26.7 Plus
trio-PA 2263 CG18214-PA 1246..1521 88..365 161 26.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:18:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18604-PA 504 GI18604-PA 1..504 5..464 1771 67.7 Plus
Dmoj\GI18603-PA 579 GI18603-PA 216..470 117..372 563 44.4 Plus
Dmoj\GI21547-PA 347 GI21547-PA 18..249 124..355 333 37.2 Plus
Dmoj\GI12875-PA 888 GI12875-PA 329..568 119..358 194 28.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:18:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17235-PA 508 GL17235-PA 4..508 8..464 1987 76.2 Plus
Dper\GL17234-PA 576 GL17234-PA 213..514 117..436 562 39.3 Plus
Dper\GL26580-PA 912 GL26580-PA 345..584 119..358 195 28.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:18:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13847-PB 463 GA13847-PB 4..463 8..464 2032 83.4 Plus
Dpse\GA13847-PA 498 GA13847-PA 4..498 8..464 1991 77.5 Plus
Dpse\GA15855-PD 664 GA15855-PD 301..606 117..440 563 38.8 Plus
Dpse\GA15855-PB 679 GA15855-PB 316..617 117..436 558 39.3 Plus
Dpse\GA23678-PA 862 GA23678-PA 293..532 119..358 194 28.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:18:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21758-PA 508 GM21758-PA 1..508 1..464 2364 89 Plus
Dsec\GM21757-PA 593 GM21757-PA 230..484 117..372 562 44.7 Plus
Dsec\GM14862-PA 1394 GM14862-PA 838..1077 119..358 199 29 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:18:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11249-PA 508 GD11249-PA 1..508 1..464 2355 88.8 Plus
Dsim\GD11248-PA 956 GD11248-PA 593..847 117..372 562 44.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:18:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21620-PA 513 GJ21620-PA 1..513 5..464 1770 66.7 Plus
Dvir\GJ21619-PA 671 GJ21619-PA 308..609 117..436 568 39.6 Plus
Dvir\GJ15693-PA 347 GJ15693-PA 28..271 124..367 414 36.2 Plus
Dvir\GJ13016-PA 1670 GJ13016-PA 1092..1331 119..358 195 28.5 Plus
Dvir\GJ12704-PA 539 GJ12704-PA 188..479 78..375 174 24.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:18:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17871-PA 520 GK17871-PA 1..520 5..464 1770 68 Plus
Dwil\GK17870-PA 764 GK17870-PA 401..655 117..372 576 45.1 Plus
Dwil\GK17395-PA 1990 GK17395-PA 1409..1648 119..358 188 27.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:18:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11647-PA 508 GE11647-PA 1..508 1..464 2289 86 Plus
Dyak\GE11646-PA 593 GE11646-PA 230..484 117..372 564 44.7 Plus
Dyak\GE21634-PA 1902 GE21634-PA 1346..1585 119..358 198 29 Plus

RE34668.hyp Sequence

Translation from 147 to 1541

> RE34668.hyp
MELSLFTLNLFDVVSVVLTFLVIFLVQILNVYLHILDDNADNGKSIDVVD
KAPAKECPLLESQSPSSPIATTLPKSQASSNGKLEKQISLLDSDSHEDED
TLSLENLFPCDQTEIYASKKISFIIDELIQTEVNYVNNLKKGMLNYGQLK
DVEDLPEALSGETKQKMLLGNIKEILELHEKEILPLMLRNQRDLKGLFDE
FAAHFEKNSFYCYVSFTMGKKSSMQLRQDNRLWLQTYQTQIKDKLGIDSF
LVQPIQRLTRYPLLLQQFISEFYKSGISCKPVLTAVCKLETRMRRALDVV
NQAEEIPNIEELNELDVLQLGNFRRATEFDAQHFPTRKKYRSKVFLFDRC
LVCTEVRKKRLAYRQHYNWEHVELQRPLDSVSSNANKIINLLVKQEEGGS
SVGSKREEYSFMAAEASVVKQWLQATHKIIEIARNEHARRNTFSLPMDLV
LGVVLAIWLIWQYL*

RE34668.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:25:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG15611-PB 464 CG15611-PB 1..464 1..464 2367 100 Plus
CG15611-PA 508 CG15611-PA 1..508 1..464 2312 91.3 Plus
CG30456-PC 443 CG30456-PC 80..334 117..372 555 44.4 Plus
CG30456-PD 592 CG30456-PD 229..483 117..372 555 44.4 Plus
CG30456-PB 682 CG30456-PB 319..573 117..372 555 44.4 Plus