BDGP Sequence Production Resources |
Search the DGRC for RE34924
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 349 |
Well: | 24 |
Vector: | pFlc-1 |
Associated Gene/Transcript | Rpb5-RA |
Protein status: | RE34924.pep: gold |
Preliminary Size: | 723 |
Sequenced Size: | 829 |
Gene | Date | Evidence |
---|---|---|
CG11979 | 2001-12-14 | Blastp of sequenced clone |
CG11979 | 2002-01-01 | Sim4 clustering to Release 2 |
CG11979 | 2003-01-01 | Sim4 clustering to Release 3 |
Rpb5 | 2008-04-29 | Release 5.5 accounting |
Rpb5 | 2008-08-15 | Release 5.9 accounting |
Rpb5 | 2008-12-18 | 5.12 accounting |
829 bp (829 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071329
> RE34924.complete GTAAGGTATTTTATGAAGCGGCATACACTGGTCTTACTACATTATCCGCG TGCTCTGTTTATAATTTAGAAATTGTTAATTTTTGGAAATAGCCATGGAT GACGAAGCGGAAACCTACAAGCTGTGGCGCATTCGCAAGACCATCATGCA GCTGAGCCACGATCGGGGCTACCTGGTGACCCAAGACGAGTTGGACCAGA CCTTGGAGCAGTTCAAGGAAATGTTCGGCGACAAACCCAGCGAAAAGCGA CCTGCTCGTTCCGATTTGATAGTTTTGGTGGCCCACAACGACGATCCCAC GGACCAGATGTTCGTCTTCTTTCCCGAGGAGCCGAAGATCGGCATCAAGA CAATCAAGACGTACTGCACTCGCATGCAGGAAGAGAACATCCACCGGGCC ATCGTTGTGGTGCAGGGCGGCATGACGCCCTCCGCCAAGCAATCGCTCGT AGATATGGCCCCCAAGTACATCCTGGAACAGTTTCTCGAATCCGAACTGC TGATCAACATCACGGAGCACGAACTGGTCCCGGAGCACGTGGTCATGACC GTCGAGGAGAAGCAGGAGCTGCTCAGCCGTTACAAACTGAAGGAGAACAT GTTGATGAGGATCCAGGCGGGCGATCCCGTGGCCCGGTACTTTGGACTCA AGCGCGGCCAGGTGGTTAAGATCATCCGTTCCTCTGAGACGGCGGGACGG TACATATCCTATCGATTGGTGTGCTGATCCTGGACTTATGAATTATTTTA AGAAACCTATGATTTAAGGAAAAGGCAGCGAGTTGTACACTTTAATAAAT CGCAATCTTTTCAGAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 6785839..6786652 | 814..1 | 3950 | 99 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 10898245..10899058 | 814..1 | 4070 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 10899444..10900257 | 814..1 | 4070 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
TART-B | 10654 | TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). | 10073..10111 | 781..741 | 110 | 78 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 6785839..6786652 | 1..814 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb5-RA | 1..633 | 95..727 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb5-RA | 1..633 | 95..727 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb5-RA | 1..633 | 95..727 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb5-RA | 1..633 | 95..727 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb5-RA | 1..633 | 95..727 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb5-RA | 1..814 | 1..814 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb5-RA | 1..814 | 1..814 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb5-RA | 3..816 | 1..814 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb5-RA | 1..814 | 1..814 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb5-RA | 3..816 | 1..814 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 10898245..10899058 | 1..814 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 10898245..10899058 | 1..814 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 10898245..10899058 | 1..814 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 6785750..6786563 | 1..814 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 10899444..10900257 | 1..814 | 100 | Minus |
Translation from 94 to 726
> RE34924.pep MDDEAETYKLWRIRKTIMQLSHDRGYLVTQDELDQTLEQFKEMFGDKPSE KRPARSDLIVLVAHNDDPTDQMFVFFPEEPKIGIKTIKTYCTRMQEENIH RAIVVVQGGMTPSAKQSLVDMAPKYILEQFLESELLINITEHELVPEHVV MTVEEKQELLSRYKLKENMLMRIQAGDPVARYFGLKRGQVVKIIRSSETA GRYISYRLVC*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12445-PA | 210 | GF12445-PA | 1..210 | 1..210 | 1114 | 99 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22706-PA | 210 | GG22706-PA | 1..210 | 1..210 | 1120 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20567-PA | 210 | GH20567-PA | 1..210 | 1..210 | 1110 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Rpb5-PB | 210 | CG11979-PB | 1..210 | 1..210 | 1076 | 100 | Plus |
Rpb5-PA | 210 | CG11979-PA | 1..210 | 1..210 | 1076 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19761-PA | 210 | GI19761-PA | 1..210 | 1..210 | 1106 | 98.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL16482-PA | 210 | GL16482-PA | 1..210 | 1..210 | 1116 | 99.5 | Plus |
Dper\GL10501-PA | 210 | GL10501-PA | 1..209 | 1..209 | 890 | 76.1 | Plus |
Dper\GL16452-PA | 126 | GL16452-PA | 5..99 | 1..95 | 377 | 66.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA22602-PA | 210 | GA22602-PA | 1..210 | 1..210 | 1116 | 99.5 | Plus |
Dpse\GA24393-PA | 210 | GA24393-PA | 1..209 | 1..209 | 886 | 75.6 | Plus |
Dpse\GA22581-PA | 320 | GA22581-PA | 1..208 | 1..208 | 768 | 65.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM20482-PA | 210 | GM20482-PA | 1..210 | 1..210 | 1120 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD15257-PA | 210 | GD15257-PA | 1..210 | 1..210 | 1120 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ18195-PA | 210 | GJ18195-PA | 1..210 | 1..210 | 1106 | 98.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK20665-PA | 210 | GK20665-PA | 1..210 | 1..210 | 1110 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13062-PA | 210 | GE13062-PA | 1..210 | 1..210 | 1120 | 100 | Plus |
Translation from 94 to 726
> RE34924.hyp MDDEAETYKLWRIRKTIMQLSHDRGYLVTQDELDQTLEQFKEMFGDKPSE KRPARSDLIVLVAHNDDPTDQMFVFFPEEPKIGIKTIKTYCTRMQEENIH RAIVVVQGGMTPSAKQSLVDMAPKYILEQFLESELLINITEHELVPEHVV MTVEEKQELLSRYKLKENMLMRIQAGDPVARYFGLKRGQVVKIIRSSETA GRYISYRLVC*