Clone RE34924 Report

Search the DGRC for RE34924

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:349
Well:24
Vector:pFlc-1
Associated Gene/TranscriptRpb5-RA
Protein status:RE34924.pep: gold
Preliminary Size:723
Sequenced Size:829

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11979 2001-12-14 Blastp of sequenced clone
CG11979 2002-01-01 Sim4 clustering to Release 2
CG11979 2003-01-01 Sim4 clustering to Release 3
Rpb5 2008-04-29 Release 5.5 accounting
Rpb5 2008-08-15 Release 5.9 accounting
Rpb5 2008-12-18 5.12 accounting

Clone Sequence Records

RE34924.complete Sequence

829 bp (829 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071329

> RE34924.complete
GTAAGGTATTTTATGAAGCGGCATACACTGGTCTTACTACATTATCCGCG
TGCTCTGTTTATAATTTAGAAATTGTTAATTTTTGGAAATAGCCATGGAT
GACGAAGCGGAAACCTACAAGCTGTGGCGCATTCGCAAGACCATCATGCA
GCTGAGCCACGATCGGGGCTACCTGGTGACCCAAGACGAGTTGGACCAGA
CCTTGGAGCAGTTCAAGGAAATGTTCGGCGACAAACCCAGCGAAAAGCGA
CCTGCTCGTTCCGATTTGATAGTTTTGGTGGCCCACAACGACGATCCCAC
GGACCAGATGTTCGTCTTCTTTCCCGAGGAGCCGAAGATCGGCATCAAGA
CAATCAAGACGTACTGCACTCGCATGCAGGAAGAGAACATCCACCGGGCC
ATCGTTGTGGTGCAGGGCGGCATGACGCCCTCCGCCAAGCAATCGCTCGT
AGATATGGCCCCCAAGTACATCCTGGAACAGTTTCTCGAATCCGAACTGC
TGATCAACATCACGGAGCACGAACTGGTCCCGGAGCACGTGGTCATGACC
GTCGAGGAGAAGCAGGAGCTGCTCAGCCGTTACAAACTGAAGGAGAACAT
GTTGATGAGGATCCAGGCGGGCGATCCCGTGGCCCGGTACTTTGGACTCA
AGCGCGGCCAGGTGGTTAAGATCATCCGTTCCTCTGAGACGGCGGGACGG
TACATATCCTATCGATTGGTGTGCTGATCCTGGACTTATGAATTATTTTA
AGAAACCTATGATTTAAGGAAAAGGCAGCGAGTTGTACACTTTAATAAAT
CGCAATCTTTTCAGAAAAAAAAAAAAAAA

RE34924.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:46:06
Subject Length Description Subject Range Query Range Score Percent Strand
Rpb5-RA 817 Rpb5-RA 1..814 1..814 4070 100 Plus
Rpb5.a 742 Rpb5.a 16..739 91..814 3620 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:43:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 6785839..6786652 814..1 3950 99 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:51:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:43:29
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10898245..10899058 814..1 4070 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:12:35
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10899444..10900257 814..1 4070 100 Minus
Blast to na_te.dros performed 2019-03-16 19:43:29
Subject Length Description Subject Range Query Range Score Percent Strand
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 10073..10111 781..741 110 78 Minus

RE34924.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:44:15 Download gff for RE34924.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 6785839..6786652 1..814 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:11:27 Download gff for RE34924.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb5-RA 1..633 95..727 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:13:24 Download gff for RE34924.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb5-RA 1..633 95..727 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:46:31 Download gff for RE34924.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb5-RA 1..633 95..727 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:37:33 Download gff for RE34924.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb5-RA 1..633 95..727 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:41:17 Download gff for RE34924.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb5-RA 1..633 95..727 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:44:36 Download gff for RE34924.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb5-RA 1..814 1..814 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:13:24 Download gff for RE34924.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb5-RA 1..814 1..814 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:46:31 Download gff for RE34924.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb5-RA 3..816 1..814 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:37:33 Download gff for RE34924.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb5-RA 1..814 1..814 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:41:17 Download gff for RE34924.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb5-RA 3..816 1..814 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:44:15 Download gff for RE34924.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10898245..10899058 1..814 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:44:15 Download gff for RE34924.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10898245..10899058 1..814 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:44:15 Download gff for RE34924.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10898245..10899058 1..814 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:46:31 Download gff for RE34924.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6785750..6786563 1..814 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:15:12 Download gff for RE34924.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10899444..10900257 1..814 100   Minus

RE34924.pep Sequence

Translation from 94 to 726

> RE34924.pep
MDDEAETYKLWRIRKTIMQLSHDRGYLVTQDELDQTLEQFKEMFGDKPSE
KRPARSDLIVLVAHNDDPTDQMFVFFPEEPKIGIKTIKTYCTRMQEENIH
RAIVVVQGGMTPSAKQSLVDMAPKYILEQFLESELLINITEHELVPEHVV
MTVEEKQELLSRYKLKENMLMRIQAGDPVARYFGLKRGQVVKIIRSSETA
GRYISYRLVC*

RE34924.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:21:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12445-PA 210 GF12445-PA 1..210 1..210 1114 99 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:21:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22706-PA 210 GG22706-PA 1..210 1..210 1120 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:21:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20567-PA 210 GH20567-PA 1..210 1..210 1110 98.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:34:27
Subject Length Description Subject Range Query Range Score Percent Strand
Rpb5-PB 210 CG11979-PB 1..210 1..210 1076 100 Plus
Rpb5-PA 210 CG11979-PA 1..210 1..210 1076 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:21:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19761-PA 210 GI19761-PA 1..210 1..210 1106 98.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:21:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16482-PA 210 GL16482-PA 1..210 1..210 1116 99.5 Plus
Dper\GL10501-PA 210 GL10501-PA 1..209 1..209 890 76.1 Plus
Dper\GL16452-PA 126 GL16452-PA 5..99 1..95 377 66.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:21:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22602-PA 210 GA22602-PA 1..210 1..210 1116 99.5 Plus
Dpse\GA24393-PA 210 GA24393-PA 1..209 1..209 886 75.6 Plus
Dpse\GA22581-PA 320 GA22581-PA 1..208 1..208 768 65.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:21:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20482-PA 210 GM20482-PA 1..210 1..210 1120 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:21:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15257-PA 210 GD15257-PA 1..210 1..210 1120 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:21:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18195-PA 210 GJ18195-PA 1..210 1..210 1106 98.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:21:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20665-PA 210 GK20665-PA 1..210 1..210 1110 98.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:21:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13062-PA 210 GE13062-PA 1..210 1..210 1120 100 Plus

RE34924.hyp Sequence

Translation from 94 to 726

> RE34924.hyp
MDDEAETYKLWRIRKTIMQLSHDRGYLVTQDELDQTLEQFKEMFGDKPSE
KRPARSDLIVLVAHNDDPTDQMFVFFPEEPKIGIKTIKTYCTRMQEENIH
RAIVVVQGGMTPSAKQSLVDMAPKYILEQFLESELLINITEHELVPEHVV
MTVEEKQELLSRYKLKENMLMRIQAGDPVARYFGLKRGQVVKIIRSSETA
GRYISYRLVC*

RE34924.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:18:20
Subject Length Description Subject Range Query Range Score Percent Strand
Rpb5-PB 210 CG11979-PB 1..210 1..210 1076 100 Plus
Rpb5-PA 210 CG11979-PA 1..210 1..210 1076 100 Plus