Clone RE34983 Report

Search the DGRC for RE34983

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:349
Well:83
Vector:pFlc-1
Associated Gene/TranscriptCG6597-RA
Protein status:RE34983.pep: gold
Sequenced Size:1327

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6597 2003-01-01 Sim4 clustering to Release 3
CG6597 2004-03-31 Blastp of sequenced clone
CG6597 2008-04-29 Release 5.5 accounting
CG6597 2008-08-15 Release 5.9 accounting
CG6597 2008-12-18 5.12 accounting

Clone Sequence Records

RE34983.complete Sequence

1327 bp (1327 high quality bases) assembled on 2004-03-31

GenBank Submission: BT012470

> RE34983.complete
ATACTATCGCGAGTGGCCAACCCAGCTCTAATTGACGCCAAGAAATTTTG
ATTGATTTTGAAAAATATGATAACTACTTCGGAGCTAAAGTAAACTGGTC
ATATTGGGAAACATTGCGCAAAACTCAAATCCGACGGACGGAACGGACTG
ACTCTGGAAAACACATCACAATAAGTCATGCCACGGGGAAAACGCCGAGC
TGCAGATACTATTAGCGACAACATGGATCATGGTCAACCGAAGAGGGCCC
GAACCAGCTACACCAGCATACCCACACAACAGAGCAGCAGACGCCATATC
AGATTGGAAGATGGCTTCAGTCAAAAGCGTTGCATGGCCTGGTTCCAGGA
GTACACAACACCAGATGAACCGGAGACATTGGGTCCCGATGGCATGGAAA
AATTCTGCGAGGATATCGGCGTGGAGCCCGAGAATATTGTGATGCTGGTG
CTGGCCTACAAAATGGGCGCCACCCAGATGGGCTTCTTCAGCCAGCAGGA
GTGGCTAAAGGGCCTCACAGAACTCGACTGCGATTCGGCAGCGAAAATGG
TTGTGAAATTGGACTATCTGCGCAGCATACTCAACGATCCCAACTCCTTT
AAAAGCATCTACAGATACGCCTACGACTTTGCCAAGGACTCGGACCAACG
GTGTATGGATATACTCACTGCCAAAGCCATGCTTCAACTACTTTTGGGCA
AACATTGGCCTCTGTATCCACAGTTCGCACAGTTTCTAGAGCAATCAAAG
TACAAGGCGATCAACAAAGATCAGTGGTGTAATATTCTCGAGTTCTCGCG
CACCATTAGCATTGATCTATCAAACTACGATATCGACGGAGCTTGGCCCG
TCATGCTGGATGAGTTTGTTGAATGGCTGCGCCTGCAGCGGAGTCAGGTC
ACCTCCACAACCGGATCTAGCTGAGAAAAGCTGTATCGAGTCGCCTATTT
CTAGTTCAACTTTGGGAGCTCAGTGCGGAGAGGAGTTCGCGGAGACTGAG
TCGGAGATGGGATGCGATGCGATGGGATGGGAATGCTGATAAGATAGATC
GGCGAAAATTTAAGACATAACCGCAGGACACTCACTGACACCCACACCCA
CACTCAGATCCACGATCAGATCCACCAGCCACTTCTTCGGCCTAAAACAC
ACAAGCACACACTCACCCACACGGAAACACAAGGCATTTTGGAGAGACTG
CGTACACTGGCAAAGCAACCAACTATGAAACTAAACTATTGATAATATAT
TTAATGTAATAATTTATGTATTAACGACGACAACTAAGAACTAAAAAAAA
AAAAATAAAAGAAAAAAAAAAAAAAAA

RE34983.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG6597-RA 1735 CG6597-RA 88..1383 1..1296 6480 100 Plus
CG6597.a 1939 CG6597.a 398..1626 68..1296 6145 100 Plus
CG6597-RB 1959 CG6597-RB 411..1637 70..1296 6135 100 Plus
CG6597-RB 1959 CG6597-RB 7..79 1..73 350 98.6 Plus
CG6597.a 1939 CG6597.a 1..34 40..73 155 97 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:10:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 20297873..20298318 845..1296 2135 98.7 Plus
chr3L 24539361 chr3L 20297219..20297474 382..637 1280 100 Plus
chr3L 24539361 chr3L 20297533..20297743 635..845 1055 100 Plus
chr3L 24539361 chr3L 20292298..20292470 118..290 865 100 Plus
chr3L 24539361 chr3L 20296954..20297050 288..384 485 100 Plus
chr3L 24539361 chr3L 20291559..20291631 1..73 350 98.6 Plus
chr3L 24539361 chr3L 20292191..20292240 69..118 250 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:51:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:10:17
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20308747..20309198 845..1296 2260 100 Plus
3L 28110227 3L 20308093..20308348 382..637 1280 100 Plus
3L 28110227 3L 20308407..20308617 635..845 1055 100 Plus
3L 28110227 3L 20303173..20303345 118..290 865 100 Plus
3L 28110227 3L 20307828..20307924 288..384 485 100 Plus
3L 28110227 3L 20302434..20302506 1..73 350 98.6 Plus
3L 28110227 3L 20303066..20303115 69..118 250 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:50:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 20301847..20302298 845..1296 2260 100 Plus
3L 28103327 3L 20301193..20301448 382..637 1280 100 Plus
3L 28103327 3L 20301507..20301717 635..845 1055 100 Plus
3L 28103327 3L 20296273..20296445 118..290 865 100 Plus
3L 28103327 3L 20300928..20301024 288..384 485 100 Plus
3L 28103327 3L 20295534..20295606 1..73 350 98.6 Plus
3L 28103327 3L 20296166..20296215 69..118 250 100 Plus
Blast to na_te.dros performed on 2019-03-16 13:10:17 has no hits.

RE34983.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:11:27 Download gff for RE34983.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 20291559..20291627 1..69 100 -> Plus
chr3L 20292192..20292240 70..118 100 -> Plus
chr3L 20292299..20292470 119..290 100 -> Plus
chr3L 20296957..20297048 291..382 100 -> Plus
chr3L 20297220..20297473 383..636 100 -> Plus
chr3L 20297535..20297742 637..844 100 -> Plus
chr3L 20297873..20298314 845..1292 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:11:31 Download gff for RE34983.complete
Subject Subject Range Query Range Percent Splice Strand
CG6597-RB 1..747 178..924 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:38:02 Download gff for RE34983.complete
Subject Subject Range Query Range Percent Splice Strand
CG6597-RC 1..747 178..924 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:51:44 Download gff for RE34983.complete
Subject Subject Range Query Range Percent Splice Strand
CG6597-RA 1..747 178..924 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:21:49 Download gff for RE34983.complete
Subject Subject Range Query Range Percent Splice Strand
CG6597-RB 1..747 178..924 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:10:11 Download gff for RE34983.complete
Subject Subject Range Query Range Percent Splice Strand
CG6597-RA 1..747 178..924 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:45:56 Download gff for RE34983.complete
Subject Subject Range Query Range Percent Splice Strand
CG6597-RA 1..1292 1..1292 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:38:02 Download gff for RE34983.complete
Subject Subject Range Query Range Percent Splice Strand
CG6597-RA 55..1346 1..1292 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:51:44 Download gff for RE34983.complete
Subject Subject Range Query Range Percent Splice Strand
CG6597-RA 4..1295 1..1292 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:21:49 Download gff for RE34983.complete
Subject Subject Range Query Range Percent Splice Strand
CG6597-RA 1..1292 1..1292 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:10:11 Download gff for RE34983.complete
Subject Subject Range Query Range Percent Splice Strand
CG6597-RA 4..1295 1..1292 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:11:27 Download gff for RE34983.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20303174..20303345 119..290 100 -> Plus
3L 20307831..20307922 291..382 100 -> Plus
3L 20308094..20308347 383..636 100 -> Plus
3L 20308409..20308616 637..844 100 -> Plus
3L 20302434..20302502 1..69 100 -> Plus
3L 20303067..20303115 70..118 100 -> Plus
3L 20308747..20309194 845..1292 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:11:27 Download gff for RE34983.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20303174..20303345 119..290 100 -> Plus
3L 20307831..20307922 291..382 100 -> Plus
3L 20308094..20308347 383..636 100 -> Plus
3L 20308409..20308616 637..844 100 -> Plus
3L 20302434..20302502 1..69 100 -> Plus
3L 20303067..20303115 70..118 100 -> Plus
3L 20308747..20309194 845..1292 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:11:27 Download gff for RE34983.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20303174..20303345 119..290 100 -> Plus
3L 20307831..20307922 291..382 100 -> Plus
3L 20308094..20308347 383..636 100 -> Plus
3L 20308409..20308616 637..844 100 -> Plus
3L 20302434..20302502 1..69 100 -> Plus
3L 20303067..20303115 70..118 100 -> Plus
3L 20308747..20309194 845..1292 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:51:44 Download gff for RE34983.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20295534..20295602 1..69 100 -> Plus
arm_3L 20296167..20296215 70..118 100 -> Plus
arm_3L 20296274..20296445 119..290 100 -> Plus
arm_3L 20300931..20301022 291..382 100 -> Plus
arm_3L 20301194..20301447 383..636 100 -> Plus
arm_3L 20301509..20301716 637..844 100 -> Plus
arm_3L 20301847..20302294 845..1292 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:59:15 Download gff for RE34983.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20301194..20301447 383..636 100 -> Plus
3L 20301509..20301716 637..844 100 -> Plus
3L 20301847..20302294 845..1292 100   Plus
3L 20295534..20295602 1..69 100 -> Plus
3L 20296167..20296215 70..118 100 -> Plus
3L 20296274..20296445 119..290 100 -> Plus
3L 20300931..20301022 291..382 100 -> Plus

RE34983.pep Sequence

Translation from 177 to 923

> RE34983.pep
MPRGKRRAADTISDNMDHGQPKRARTSYTSIPTQQSSRRHIRLEDGFSQK
RCMAWFQEYTTPDEPETLGPDGMEKFCEDIGVEPENIVMLVLAYKMGATQ
MGFFSQQEWLKGLTELDCDSAAKMVVKLDYLRSILNDPNSFKSIYRYAYD
FAKDSDQRCMDILTAKAMLQLLLGKHWPLYPQFAQFLEQSKYKAINKDQW
CNILEFSRTISIDLSNYDIDGAWPVMLDEFVEWLRLQRSQVTSTTGSS*

RE34983.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:27:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10048-PA 246 GF10048-PA 1..246 1..248 1226 93.1 Plus
Dana\GF24079-PA 289 GF24079-PA 58..242 49..233 325 34.6 Plus
Dana\GF11995-PA 332 GF11995-PA 119..307 56..246 259 30.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:27:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16098-PA 248 GG16098-PA 1..248 1..248 1321 97.6 Plus
Dere\GG15909-PA 288 GG15909-PA 58..242 49..233 335 35.7 Plus
Dere\GG22539-PA 334 GG22539-PA 121..308 56..243 261 31.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:27:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14379-PA 246 GH14379-PA 1..246 1..248 1181 88.7 Plus
Dgri\GH14742-PA 282 GH14742-PA 58..242 49..233 316 34.1 Plus
Dgri\GH21603-PA 338 GH21603-PA 125..303 56..233 265 32 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:16:10
Subject Length Description Subject Range Query Range Score Percent Strand
SCCRO4-PE 248 CG6597-PE 1..248 1..248 1319 100 Plus
SCCRO4-PB 248 CG6597-PB 1..248 1..248 1319 100 Plus
SCCRO4-PA 248 CG6597-PA 1..248 1..248 1319 100 Plus
SCCRO4-PD 213 CG6597-PD 2..213 37..248 1123 99.1 Plus
SCCRO-PE 288 CG7427-PE 58..242 49..233 344 35.7 Plus
SCCRO-PA 288 CG7427-PA 58..242 49..233 344 35.7 Plus
SCCRO-PD 291 CG7427-PD 61..245 49..233 344 35.7 Plus
SCCRO-PB 291 CG7427-PB 61..245 49..233 344 35.7 Plus
SCCRO-PC 297 CG7427-PC 67..251 49..233 344 35.7 Plus
SCCRO3-PB 334 CG13322-PB 121..299 56..233 259 32.6 Plus
SCCRO3-PC 334 CG13322-PC 121..299 56..233 259 32.6 Plus
SCCRO3-PA 334 CG13322-PA 121..299 56..233 259 32.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:27:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11322-PA 246 GI11322-PA 1..246 1..248 1186 89.5 Plus
Dmoj\GI13120-PA 281 GI13120-PA 58..254 49..245 327 33.5 Plus
Dmoj\GI19574-PA 336 GI19574-PA 122..300 56..233 265 32.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:27:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25128-PA 244 GL25128-PA 1..244 1..247 1127 85.4 Plus
Dper\GL24888-PA 282 GL24888-PA 58..242 49..233 322 34.6 Plus
Dper\GL17317-PA 336 GL17317-PA 115..301 48..233 266 31.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:27:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23691-PA 244 GA23691-PA 1..244 1..247 1127 85.4 Plus
Dpse\GA20342-PA 282 GA20342-PA 58..242 49..233 322 34.6 Plus
Dpse\GA12204-PA 336 GA12204-PA 115..301 48..233 266 31.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:27:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22269-PA 248 GM22269-PA 1..248 1..248 1331 98.8 Plus
Dsec\GM25539-PA 239 GM25539-PA 9..193 49..233 334 35.7 Plus
Dsec\GM20324-PA 334 GM20324-PA 121..309 56..246 274 32.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:27:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14870-PA 248 GD14870-PA 1..248 1..248 1331 98.8 Plus
Dsim\GD14554-PA 288 GD14554-PA 58..242 49..233 335 35.7 Plus
Dsim\GD25802-PA 334 GD25802-PA 121..309 56..246 274 32.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:27:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11578-PA 246 GJ11578-PA 1..246 1..248 1194 90.3 Plus
Dvir\GJ13867-PA 281 GJ13867-PA 58..242 49..233 322 35.1 Plus
Dvir\GJ21150-PA 340 GJ21150-PA 127..314 56..242 266 32.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:27:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16948-PA 246 GK16948-PA 1..237 1..239 1168 91.2 Plus
Dwil\GK10601-PA 272 GK10601-PA 58..242 49..233 317 34.1 Plus
Dwil\GK20876-PA 373 GK20876-PA 131..318 56..242 264 31.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:27:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23063-PA 248 GE23063-PA 1..248 1..248 1324 98 Plus
Dyak\GE22250-PA 288 GE22250-PA 58..242 49..233 335 35.7 Plus
Dyak\GE13410-PA 334 GE13410-PA 121..299 56..233 263 32 Plus

RE34983.hyp Sequence

Translation from 177 to 923

> RE34983.hyp
MPRGKRRAADTISDNMDHGQPKRARTSYTSIPTQQSSRRHIRLEDGFSQK
RCMAWFQEYTTPDEPETLGPDGMEKFCEDIGVEPENIVMLVLAYKMGATQ
MGFFSQQEWLKGLTELDCDSAAKMVVKLDYLRSILNDPNSFKSIYRYAYD
FAKDSDQRCMDILTAKAMLQLLLGKHWPLYPQFAQFLEQSKYKAINKDQW
CNILEFSRTISIDLSNYDIDGAWPVMLDEFVEWLRLQRSQVTSTTGSS*

RE34983.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:14:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG6597-PE 248 CG6597-PE 1..248 1..248 1319 100 Plus
CG6597-PB 248 CG6597-PB 1..248 1..248 1319 100 Plus
CG6597-PA 248 CG6597-PA 1..248 1..248 1319 100 Plus
CG6597-PD 213 CG6597-PD 2..213 37..248 1123 99.1 Plus
CG7427-PE 288 CG7427-PE 58..242 49..233 344 35.7 Plus