BDGP Sequence Production Resources |
Search the DGRC for RE35078
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 350 |
Well: | 78 |
Vector: | pFlc-1 |
Associated Gene/Transcript | NDUFA8-RA |
Protein status: | RE35078.pep: gold |
Sequenced Size: | 681 |
Gene | Date | Evidence |
---|---|---|
CG3683 | 2001-12-14 | Blastp of sequenced clone |
CG3683 | 2002-01-01 | Sim4 clustering to Release 2 |
CG3683 | 2003-01-01 | Sim4 clustering to Release 3 |
CG3683 | 2008-04-29 | Release 5.5 accounting |
CG3683 | 2008-08-15 | Release 5.9 accounting |
CG3683 | 2008-12-18 | 5.12 accounting |
681 bp (681 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071332
> RE35078.complete ATCTAAATCAGCTGTTGTGTTGTAAGCAAACGTTTTTGGTTGATCGCACA GGACTGCAACGCTATTATGGTCATCACCAACAACACAACACTGCCCGAGG AGTCGGAGCTGAACGTCCAGGAGCTAAATCTATCGTCGGCGGCCTTACGG GCAGGCGCCTTCCATTTGGGCAAGCAATGCGAGCAGGCCAATAATGAGTT TATGCTGTGCCGGCAGGAGCTGGATGACCCGCGAGCCTGTTTGGCGGAGG GCAAAGCCGTGACCAGCTGCGCCCTGGACTTCTTCCGCAAGGTGAAGAAG ACCTGCCATGAGGAGTTCACGCAGTACGCCACCTGCCTGGATAAGAGCAG CGGTACTATGGCTTTTTCACATTGCCGCAAGACCCAGGGAGTGTTCGACA AGTGTATCAAAGATAACTTCGACTGGGATCGTCCCTCCTATGGATACTTC TCGAGGGCCAAGGTCATCCAATCAGCTCGGGAAGCACCCAAGAAGGAGGA GAAGGTCTCCTATCCCGATGCCACCCCCGGTTTGCCCGAGGATTACCCCA AGCCGCCAGCAAAGTACGGTTCCCGCTTCCACTGGCTGGAGTAGACAGCT GCCAGCGCCTAGTGAAATTTGAAAGCGTTCATCTTAATATAAACTCTTGT TTCCATTAGTACTCGAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG3683-RB | 703 | CG3683-RB | 39..703 | 1..665 | 3325 | 100 | Plus |
CG3683-RA | 711 | CG3683-RA | 78..711 | 32..665 | 3170 | 100 | Plus |
CG3683.a | 1068 | CG3683.a | 426..896 | 196..666 | 2355 | 100 | Plus |
CG3683.a | 1068 | CG3683.a | 88..252 | 32..196 | 825 | 100 | Plus |
CG3683.a | 1068 | CG3683.a | 49..79 | 1..31 | 155 | 100 | Plus |
CG3683-RA | 711 | CG3683-RA | 39..69 | 1..31 | 155 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 20551127..20551331 | 461..665 | 1025 | 100 | Plus |
chr2R | 21145070 | chr2R | 20550746..20550921 | 196..371 | 880 | 100 | Plus |
chr2R | 21145070 | chr2R | 20550408..20550572 | 32..196 | 825 | 100 | Plus |
chr2R | 21145070 | chr2R | 20550985..20551077 | 372..464 | 465 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 24665235..24665440 | 461..666 | 1030 | 100 | Plus |
2R | 25286936 | 2R | 24664854..24665029 | 196..371 | 880 | 100 | Plus |
2R | 25286936 | 2R | 24664516..24664680 | 32..196 | 825 | 100 | Plus |
2R | 25286936 | 2R | 24665093..24665185 | 372..464 | 465 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 24666434..24666639 | 461..666 | 1030 | 100 | Plus |
2R | 25260384 | 2R | 24666053..24666228 | 196..371 | 880 | 100 | Plus |
2R | 25260384 | 2R | 24665715..24665879 | 32..196 | 825 | 100 | Plus |
2R | 25260384 | 2R | 24666292..24666384 | 372..464 | 465 | 100 | Plus |
2R | 25260384 | 2R | 24665625..24665657 | 1..33 | 165 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 20551129..20551331 | 463..665 | 100 | Plus | |
chr2R | 20550318..20550348 | 1..31 | 100 | -> | Plus |
chr2R | 20550408..20550571 | 32..195 | 100 | -> | Plus |
chr2R | 20550746..20550921 | 196..371 | 100 | -> | Plus |
chr2R | 20550985..20551075 | 372..462 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG3683-RC | 1..528 | 67..594 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG3683-RC | 1..528 | 67..594 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
NDUFA8-RB | 1..528 | 67..594 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG3683-RC | 1..528 | 67..594 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
NDUFA8-RB | 1..528 | 67..594 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG3683-RB | 2..666 | 1..665 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG3683-RB | 2..666 | 1..665 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
NDUFA8-RB | 4..668 | 1..665 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG3683-RB | 2..666 | 1..665 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
NDUFA8-RB | 4..668 | 1..665 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24664426..24664456 | 1..31 | 100 | -> | Plus |
2R | 24664516..24664679 | 32..195 | 100 | -> | Plus |
2R | 24664854..24665029 | 196..371 | 100 | -> | Plus |
2R | 24665093..24665183 | 372..462 | 100 | -> | Plus |
2R | 24665237..24665439 | 463..665 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24664426..24664456 | 1..31 | 100 | -> | Plus |
2R | 24664516..24664679 | 32..195 | 100 | -> | Plus |
2R | 24664854..24665029 | 196..371 | 100 | -> | Plus |
2R | 24665093..24665183 | 372..462 | 100 | -> | Plus |
2R | 24665237..24665439 | 463..665 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24664426..24664456 | 1..31 | 100 | -> | Plus |
2R | 24664516..24664679 | 32..195 | 100 | -> | Plus |
2R | 24664854..24665029 | 196..371 | 100 | -> | Plus |
2R | 24665093..24665183 | 372..462 | 100 | -> | Plus |
2R | 24665237..24665439 | 463..665 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 20552760..20552962 | 463..665 | 100 | Plus | |
arm_2R | 20551949..20551979 | 1..31 | 100 | -> | Plus |
arm_2R | 20552039..20552202 | 32..195 | 100 | -> | Plus |
arm_2R | 20552377..20552552 | 196..371 | 100 | -> | Plus |
arm_2R | 20552616..20552706 | 372..462 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24665643..24665673 | 1..31 | 100 | -> | Plus |
2R | 24665733..24665896 | 32..195 | 100 | -> | Plus |
2R | 24666071..24666246 | 196..371 | 100 | -> | Plus |
2R | 24666310..24666400 | 372..462 | 100 | -> | Plus |
2R | 24666454..24666656 | 463..665 | 100 | Plus |
Translation from 66 to 593
> RE35078.pep MVITNNTTLPEESELNVQELNLSSAALRAGAFHLGKQCEQANNEFMLCRQ ELDDPRACLAEGKAVTSCALDFFRKVKKTCHEEFTQYATCLDKSSGTMAF SHCRKTQGVFDKCIKDNFDWDRPSYGYFSRAKVIQSAREAPKKEEKVSYP DATPGLPEDYPKPPAKYGSRFHWLE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13000-PA | 175 | GF13000-PA | 1..175 | 1..175 | 876 | 89.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22998-PA | 175 | GG22998-PA | 1..175 | 1..175 | 939 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20328-PA | 175 | GH20328-PA | 1..175 | 1..175 | 838 | 85.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
ND-19-PD | 175 | CG3683-PD | 1..175 | 1..175 | 947 | 100 | Plus |
ND-19-PC | 175 | CG3683-PC | 1..175 | 1..175 | 947 | 100 | Plus |
ND-19-PB | 175 | CG3683-PB | 1..175 | 1..175 | 947 | 100 | Plus |
ND-19-PA | 175 | CG3683-PA | 1..175 | 1..175 | 947 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19999-PA | 175 | GI19999-PA | 1..175 | 1..175 | 842 | 86.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11000-PA | 175 | GL11000-PA | 1..175 | 1..175 | 895 | 93.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA17610-PA | 175 | GA17610-PA | 1..175 | 1..175 | 895 | 93.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM11892-PA | 175 | GM11892-PA | 1..175 | 1..175 | 947 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11890-PA | 175 | GD11890-PA | 1..175 | 1..175 | 947 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ21249-PA | 175 | GJ21249-PA | 1..175 | 1..175 | 846 | 87.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK21425-PA | 175 | GK21425-PA | 1..175 | 1..175 | 870 | 89.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE14435-PA | 175 | GE14435-PA | 1..175 | 1..175 | 932 | 96.6 | Plus |
Translation from 66 to 593
> RE35078.hyp MVITNNTTLPEESELNVQELNLSSAALRAGAFHLGKQCEQANNEFMLCRQ ELDDPRACLAEGKAVTSCALDFFRKVKKTCHEEFTQYATCLDKSSGTMAF SHCRKTQGVFDKCIKDNFDWDRPSYGYFSRAKVIQSAREAPKKEEKVSYP DATPGLPEDYPKPPAKYGSRFHWLE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
NDUFA8-PD | 175 | CG3683-PD | 1..175 | 1..175 | 947 | 100 | Plus |
NDUFA8-PC | 175 | CG3683-PC | 1..175 | 1..175 | 947 | 100 | Plus |
NDUFA8-PB | 175 | CG3683-PB | 1..175 | 1..175 | 947 | 100 | Plus |
NDUFA8-PA | 175 | CG3683-PA | 1..175 | 1..175 | 947 | 100 | Plus |