Clone RE35078 Report

Search the DGRC for RE35078

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:350
Well:78
Vector:pFlc-1
Associated Gene/TranscriptNDUFA8-RA
Protein status:RE35078.pep: gold
Sequenced Size:681

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3683 2001-12-14 Blastp of sequenced clone
CG3683 2002-01-01 Sim4 clustering to Release 2
CG3683 2003-01-01 Sim4 clustering to Release 3
CG3683 2008-04-29 Release 5.5 accounting
CG3683 2008-08-15 Release 5.9 accounting
CG3683 2008-12-18 5.12 accounting

Clone Sequence Records

RE35078.complete Sequence

681 bp (681 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071332

> RE35078.complete
ATCTAAATCAGCTGTTGTGTTGTAAGCAAACGTTTTTGGTTGATCGCACA
GGACTGCAACGCTATTATGGTCATCACCAACAACACAACACTGCCCGAGG
AGTCGGAGCTGAACGTCCAGGAGCTAAATCTATCGTCGGCGGCCTTACGG
GCAGGCGCCTTCCATTTGGGCAAGCAATGCGAGCAGGCCAATAATGAGTT
TATGCTGTGCCGGCAGGAGCTGGATGACCCGCGAGCCTGTTTGGCGGAGG
GCAAAGCCGTGACCAGCTGCGCCCTGGACTTCTTCCGCAAGGTGAAGAAG
ACCTGCCATGAGGAGTTCACGCAGTACGCCACCTGCCTGGATAAGAGCAG
CGGTACTATGGCTTTTTCACATTGCCGCAAGACCCAGGGAGTGTTCGACA
AGTGTATCAAAGATAACTTCGACTGGGATCGTCCCTCCTATGGATACTTC
TCGAGGGCCAAGGTCATCCAATCAGCTCGGGAAGCACCCAAGAAGGAGGA
GAAGGTCTCCTATCCCGATGCCACCCCCGGTTTGCCCGAGGATTACCCCA
AGCCGCCAGCAAAGTACGGTTCCCGCTTCCACTGGCTGGAGTAGACAGCT
GCCAGCGCCTAGTGAAATTTGAAAGCGTTCATCTTAATATAAACTCTTGT
TTCCATTAGTACTCGAAAAAAAAAAAAAAAA

RE35078.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:43:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG3683-RB 703 CG3683-RB 39..703 1..665 3325 100 Plus
CG3683-RA 711 CG3683-RA 78..711 32..665 3170 100 Plus
CG3683.a 1068 CG3683.a 426..896 196..666 2355 100 Plus
CG3683.a 1068 CG3683.a 88..252 32..196 825 100 Plus
CG3683.a 1068 CG3683.a 49..79 1..31 155 100 Plus
CG3683-RA 711 CG3683-RA 39..69 1..31 155 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:11:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 20551127..20551331 461..665 1025 100 Plus
chr2R 21145070 chr2R 20550746..20550921 196..371 880 100 Plus
chr2R 21145070 chr2R 20550408..20550572 32..196 825 100 Plus
chr2R 21145070 chr2R 20550985..20551077 372..464 465 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:51:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:11:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24665235..24665440 461..666 1030 100 Plus
2R 25286936 2R 24664854..24665029 196..371 880 100 Plus
2R 25286936 2R 24664516..24664680 32..196 825 100 Plus
2R 25286936 2R 24665093..24665185 372..464 465 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:10:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24666434..24666639 461..666 1030 100 Plus
2R 25260384 2R 24666053..24666228 196..371 880 100 Plus
2R 25260384 2R 24665715..24665879 32..196 825 100 Plus
2R 25260384 2R 24666292..24666384 372..464 465 100 Plus
2R 25260384 2R 24665625..24665657 1..33 165 100 Plus
Blast to na_te.dros performed on 2019-03-16 12:11:23 has no hits.

RE35078.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:12:02 Download gff for RE35078.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 20551129..20551331 463..665 100   Plus
chr2R 20550318..20550348 1..31 100 -> Plus
chr2R 20550408..20550571 32..195 100 -> Plus
chr2R 20550746..20550921 196..371 100 -> Plus
chr2R 20550985..20551075 372..462 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:11:36 Download gff for RE35078.complete
Subject Subject Range Query Range Percent Splice Strand
CG3683-RC 1..528 67..594 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:10:07 Download gff for RE35078.complete
Subject Subject Range Query Range Percent Splice Strand
CG3683-RC 1..528 67..594 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:01:48 Download gff for RE35078.complete
Subject Subject Range Query Range Percent Splice Strand
NDUFA8-RB 1..528 67..594 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:34:17 Download gff for RE35078.complete
Subject Subject Range Query Range Percent Splice Strand
CG3683-RC 1..528 67..594 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:40:29 Download gff for RE35078.complete
Subject Subject Range Query Range Percent Splice Strand
NDUFA8-RB 1..528 67..594 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:39:51 Download gff for RE35078.complete
Subject Subject Range Query Range Percent Splice Strand
CG3683-RB 2..666 1..665 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:10:07 Download gff for RE35078.complete
Subject Subject Range Query Range Percent Splice Strand
CG3683-RB 2..666 1..665 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:01:48 Download gff for RE35078.complete
Subject Subject Range Query Range Percent Splice Strand
NDUFA8-RB 4..668 1..665 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:34:17 Download gff for RE35078.complete
Subject Subject Range Query Range Percent Splice Strand
CG3683-RB 2..666 1..665 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:40:29 Download gff for RE35078.complete
Subject Subject Range Query Range Percent Splice Strand
NDUFA8-RB 4..668 1..665 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:12:02 Download gff for RE35078.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24664426..24664456 1..31 100 -> Plus
2R 24664516..24664679 32..195 100 -> Plus
2R 24664854..24665029 196..371 100 -> Plus
2R 24665093..24665183 372..462 100 -> Plus
2R 24665237..24665439 463..665 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:12:02 Download gff for RE35078.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24664426..24664456 1..31 100 -> Plus
2R 24664516..24664679 32..195 100 -> Plus
2R 24664854..24665029 196..371 100 -> Plus
2R 24665093..24665183 372..462 100 -> Plus
2R 24665237..24665439 463..665 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:12:02 Download gff for RE35078.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24664426..24664456 1..31 100 -> Plus
2R 24664516..24664679 32..195 100 -> Plus
2R 24664854..24665029 196..371 100 -> Plus
2R 24665093..24665183 372..462 100 -> Plus
2R 24665237..24665439 463..665 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:01:48 Download gff for RE35078.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20552760..20552962 463..665 100   Plus
arm_2R 20551949..20551979 1..31 100 -> Plus
arm_2R 20552039..20552202 32..195 100 -> Plus
arm_2R 20552377..20552552 196..371 100 -> Plus
arm_2R 20552616..20552706 372..462 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:11:28 Download gff for RE35078.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24665643..24665673 1..31 100 -> Plus
2R 24665733..24665896 32..195 100 -> Plus
2R 24666071..24666246 196..371 100 -> Plus
2R 24666310..24666400 372..462 100 -> Plus
2R 24666454..24666656 463..665 100   Plus

RE35078.pep Sequence

Translation from 66 to 593

> RE35078.pep
MVITNNTTLPEESELNVQELNLSSAALRAGAFHLGKQCEQANNEFMLCRQ
ELDDPRACLAEGKAVTSCALDFFRKVKKTCHEEFTQYATCLDKSSGTMAF
SHCRKTQGVFDKCIKDNFDWDRPSYGYFSRAKVIQSAREAPKKEEKVSYP
DATPGLPEDYPKPPAKYGSRFHWLE*

RE35078.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:10:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13000-PA 175 GF13000-PA 1..175 1..175 876 89.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:10:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22998-PA 175 GG22998-PA 1..175 1..175 939 98.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:10:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20328-PA 175 GH20328-PA 1..175 1..175 838 85.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:09
Subject Length Description Subject Range Query Range Score Percent Strand
ND-19-PD 175 CG3683-PD 1..175 1..175 947 100 Plus
ND-19-PC 175 CG3683-PC 1..175 1..175 947 100 Plus
ND-19-PB 175 CG3683-PB 1..175 1..175 947 100 Plus
ND-19-PA 175 CG3683-PA 1..175 1..175 947 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:10:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19999-PA 175 GI19999-PA 1..175 1..175 842 86.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:10:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11000-PA 175 GL11000-PA 1..175 1..175 895 93.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:10:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17610-PA 175 GA17610-PA 1..175 1..175 895 93.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:10:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11892-PA 175 GM11892-PA 1..175 1..175 947 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:10:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11890-PA 175 GD11890-PA 1..175 1..175 947 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:10:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21249-PA 175 GJ21249-PA 1..175 1..175 846 87.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:10:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21425-PA 175 GK21425-PA 1..175 1..175 870 89.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:10:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14435-PA 175 GE14435-PA 1..175 1..175 932 96.6 Plus

RE35078.hyp Sequence

Translation from 66 to 593

> RE35078.hyp
MVITNNTTLPEESELNVQELNLSSAALRAGAFHLGKQCEQANNEFMLCRQ
ELDDPRACLAEGKAVTSCALDFFRKVKKTCHEEFTQYATCLDKSSGTMAF
SHCRKTQGVFDKCIKDNFDWDRPSYGYFSRAKVIQSAREAPKKEEKVSYP
DATPGLPEDYPKPPAKYGSRFHWLE*

RE35078.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:45:38
Subject Length Description Subject Range Query Range Score Percent Strand
NDUFA8-PD 175 CG3683-PD 1..175 1..175 947 100 Plus
NDUFA8-PC 175 CG3683-PC 1..175 1..175 947 100 Plus
NDUFA8-PB 175 CG3683-PB 1..175 1..175 947 100 Plus
NDUFA8-PA 175 CG3683-PA 1..175 1..175 947 100 Plus