Clone RE35159 Report

Search the DGRC for RE35159

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:351
Well:59
Vector:pFlc-1
Associated Gene/TranscriptCG11437-RA
Protein status:RE35159.pep: gold
Preliminary Size:918
Sequenced Size:1006

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11437 2002-01-01 Sim4 clustering to Release 2
CG11437 2002-03-28 Blastp of sequenced clone
CG11437 2003-01-01 Sim4 clustering to Release 3
CG11437 2008-04-29 Release 5.5 accounting
CG11437 2008-08-15 Release 5.9 accounting
CG11437 2008-12-18 5.12 accounting

Clone Sequence Records

RE35159.complete Sequence

1006 bp (1006 high quality bases) assembled on 2002-03-28

GenBank Submission: AY094867

> RE35159.complete
AGTGAGAAAATGTGCGGCAATCCGAACACGCGTCTCCTCTCCCGGCTGGT
CATTGACTTCCTGATTCTCCTAGGAATCTATGGAGCGGCCCTAGTGGTGC
TGCCCCAGCAGTTGTCCACGGCCCAACGGGGATTCCACTGCAGTGATACC
AGCCTGAAGTATCCCTATCGCCAGCCCTGGCTGACCAAGGTCCACCTTAC
GATCGCAGTGGTTGCTCTGCCCGCTGCATTTGTGCTCGTGGTGGAGATGC
TCAGGGCTGCCGTGGTACCCAGCTCCACGGAGCTGACGCAGCGCTTCGTC
TTCGTCGGGGTCCGCATCCCCAGATTCATCAGCGAATGCTACAAGGCCAT
TGGCGTTTACCTATTCGGTCTGGGGCTGACCTTGGCGGCGATTCGGCTGA
CTAAGCACTCGACGGGCCGACTGAGGCCCTACTTCTTCGATATCTGCCAG
CCCACATGGGGAACAGAGGGCGGCGAGAGCTGCTCCGACGTGACCGCGCA
GAACTCCACCCTCTACCTCGAGGACTTCAGTTGCACGGAGTTCGCCGCCT
CGCAGGATCTGCTCGCCCTGGTGCGCCACTCCTTCCCCAGCGGATTCGTG
TCCACCACTTGCTACGCCATGGGCTTTCTGATTTTTTATTCCCAGGCCAG
ATTGTTTGCTCCCTGGCTGCGATTAGTCCGAGCCTCCCTGCAACTGGCTT
GTTGCTCTCTGGCCTTGGTGGTTTGCTGGGAGCGCATCTCTACCTACCAG
AACCACTTAACAGATGTGGCAGCTGGAGCTGCCCTTGGTGGGTGGATGGC
CTTCTTTGCAACAGTATTTGTGGCCCACCTCTTTGTGGAGGTGCGAGTAA
AACGCCGTCCCATGCCAAGAAATGAACAGATCTACGGCTACGCGGGATAC
TACACCAGAGCCACCTACGGCTACTGACATTCGATGTGTTAACTTTTCTG
AACTTACATAACACTGGTAATAAAAGTATTTTCATATTTGAAAAAAAAAA
AAAAAA

RE35159.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:56:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG11437.b 1092 CG11437.b 96..1087 1..992 4945 99.8 Plus
CG11437-RA 997 CG11437-RA 1..992 1..992 4945 99.8 Plus
CG11437.a 993 CG11437.a 68..988 72..992 4605 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:15:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 22457772..22458761 1..990 4935 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:51:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:15:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 22468864..22469855 1..992 4945 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:15:09
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 22461964..22462955 1..992 4945 99.8 Plus
Blast to na_te.dros performed on 2019-03-16 12:15:43 has no hits.

RE35159.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:16:54 Download gff for RE35159.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 22457772..22458761 1..990 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:11:40 Download gff for RE35159.complete
Subject Subject Range Query Range Percent Splice Strand
CG11437-RA 1..918 10..927 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:53:57 Download gff for RE35159.complete
Subject Subject Range Query Range Percent Splice Strand
CG11437-RA 1..918 10..927 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:02:26 Download gff for RE35159.complete
Subject Subject Range Query Range Percent Splice Strand
CG11437-RA 1..918 10..927 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:36:25 Download gff for RE35159.complete
Subject Subject Range Query Range Percent Splice Strand
CG11437-RA 1..918 10..927 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:40:33 Download gff for RE35159.complete
Subject Subject Range Query Range Percent Splice Strand
CG11437-RA 1..918 10..927 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:06:29 Download gff for RE35159.complete
Subject Subject Range Query Range Percent Splice Strand
CG11437-RA 1..990 1..990 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:53:56 Download gff for RE35159.complete
Subject Subject Range Query Range Percent Splice Strand
CG11437-RA 1..990 1..990 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:02:26 Download gff for RE35159.complete
Subject Subject Range Query Range Percent Splice Strand
CG11437-RA 3..992 1..990 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:36:25 Download gff for RE35159.complete
Subject Subject Range Query Range Percent Splice Strand
CG11437-RA 1..990 1..990 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:40:33 Download gff for RE35159.complete
Subject Subject Range Query Range Percent Splice Strand
CG11437-RA 3..992 1..990 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:16:54 Download gff for RE35159.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22468864..22469853 1..990 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:16:54 Download gff for RE35159.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22468864..22469853 1..990 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:16:54 Download gff for RE35159.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22468864..22469853 1..990 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:02:26 Download gff for RE35159.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 22461964..22462953 1..990 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:19:05 Download gff for RE35159.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22461964..22462953 1..990 99   Plus

RE35159.hyp Sequence

Translation from 0 to 926

> RE35159.hyp
SVKMCGNPNTRLLSRLVIDFLILLGIYGAALVVLPQQLSTAQRGFHCSDT
SLKYPYRQPWLTKVHLTIAVVALPAAFVLVVEMLRAAVVPSSTELTQRFV
FVGVRIPRFISECYKAIGVYLFGLGLTLAAIRLTKHSTGRLRPYFFDICQ
PTWGTEGGESCSDVTAQNSTLYLEDFSCTEFAASQDLLALVRHSFPSGFV
STTCYAMGFLIFYSQARLFAPWLRLVRASLQLACCSLALVVCWERISTYQ
NHLTDVAAGAALGGWMAFFATVFVAHLFVEVRVKRRPMPRNEQIYGYAGY
YTRATYGY*

RE35159.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:36:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG11437-PA 305 CG11437-PA 1..305 4..308 1595 100 Plus
wun-PA 300 CG8804-PA 4..277 9..284 384 33.3 Plus
wun-PB 379 CG8804-PB 83..356 9..284 384 33.3 Plus
wun-PC 364 CG8804-PC 83..335 9..263 369 34.1 Plus
wun2-PA 350 CG8805-PA 86..338 11..263 363 32.8 Plus

RE35159.pep Sequence

Translation from 9 to 926

> RE35159.pep
MCGNPNTRLLSRLVIDFLILLGIYGAALVVLPQQLSTAQRGFHCSDTSLK
YPYRQPWLTKVHLTIAVVALPAAFVLVVEMLRAAVVPSSTELTQRFVFVG
VRIPRFISECYKAIGVYLFGLGLTLAAIRLTKHSTGRLRPYFFDICQPTW
GTEGGESCSDVTAQNSTLYLEDFSCTEFAASQDLLALVRHSFPSGFVSTT
CYAMGFLIFYSQARLFAPWLRLVRASLQLACCSLALVVCWERISTYQNHL
TDVAAGAALGGWMAFFATVFVAHLFVEVRVKRRPMPRNEQIYGYAGYYTR
ATYGY*

RE35159.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:59:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10979-PA 305 GF10979-PA 1..305 1..305 1236 77.7 Plus
Dana\GF13080-PA 377 GF13080-PA 76..359 4..290 400 33.4 Plus
Dana\GF11822-PA 347 GF11822-PA 85..335 8..260 352 33.6 Plus
Dana\GF10978-PA 335 GF10978-PA 7..257 10..279 322 34.1 Plus
Dana\GF23463-PA 331 GF23463-PA 1..235 35..291 284 33.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:59:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16257-PA 304 GG16257-PA 1..304 1..305 1487 93.1 Plus
Dere\GG10557-PA 372 GG10557-PA 74..349 4..281 383 32.7 Plus
Dere\GG23436-PA 351 GG23436-PA 87..339 8..260 371 33.3 Plus
Dere\GG16256-PA 341 GG16256-PA 7..271 10..279 322 34.7 Plus
Dere\GG13182-PA 337 GG13182-PA 1..221 35..272 268 32.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:59:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16693-PA 305 GH16693-PA 1..305 1..305 1165 75.7 Plus
Dgri\GH21309-PA 380 GH21309-PA 86..366 4..290 400 33 Plus
Dgri\GH20575-PA 365 GH20575-PA 103..356 8..260 398 37.5 Plus
Dgri\GH16692-PA 348 GH16692-PA 7..270 10..282 342 33 Plus
Dgri\GH14815-PA 385 GH14815-PA 1..225 35..275 286 32.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG11437-PA 305 CG11437-PA 1..305 1..305 1595 100 Plus
wun-PA 300 CG8804-PA 4..277 6..281 384 33.3 Plus
wun-PB 379 CG8804-PB 83..356 6..281 384 33.3 Plus
wun-PC 364 CG8804-PC 83..335 6..260 369 34.1 Plus
wun2-PA 350 CG8805-PA 86..338 8..260 363 32.8 Plus
wun2-PB 246 CG8805-PB 12..234 39..260 355 34.6 Plus
CG11438-PB 341 CG11438-PB 7..269 10..279 318 33.3 Plus
CG11438-PA 341 CG11438-PA 7..269 10..279 318 33.3 Plus
laza-PA 334 CG11440-PA 1..223 35..274 317 34.7 Plus
CG11426-PA 340 CG11426-PA 33..292 8..275 297 29.9 Plus
CG11425-PA 305 CG11425-PA 1..255 1..268 247 29.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:59:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11381-PA 308 GI11381-PA 1..308 1..305 1252 75.6 Plus
Dmoj\GI19743-PA 298 GI19743-PA 2..284 4..290 421 34.9 Plus
Dmoj\GI19768-PA 375 GI19768-PA 113..371 9..268 351 31.4 Plus
Dmoj\GI11380-PA 340 GI11380-PA 7..271 10..282 329 33 Plus
Dmoj\GI13921-PA 361 GI13921-PA 1..224 35..275 279 31.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:59:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23154-PA 307 GL23154-PA 1..307 1..305 1290 82.1 Plus
Dper\GL16886-PA 306 GL16886-PA 2..288 4..293 411 33.4 Plus
Dper\GL17588-PA 372 GL17588-PA 106..360 8..260 356 32.2 Plus
Dper\GL23143-PA 328 GL23143-PA 7..254 10..279 250 29.6 Plus
Dper\GL23165-PA 343 GL23165-PA 63..292 39..275 242 30.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:59:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11004-PA 307 GA11004-PA 1..307 1..305 1293 82.4 Plus
Dpse\GA21332-PC 306 GA21332-PC 2..288 4..293 404 32.8 Plus
Dpse\GA21332-PA 386 GA21332-PA 82..368 4..293 402 32.8 Plus
Dpse\GA21332-PB 365 GA21332-PB 82..336 4..260 383 33.8 Plus
Dpse\GA24835-PA 369 GA24835-PA 103..357 8..260 353 31.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:59:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22446-PA 305 GM22446-PA 1..305 1..305 1554 96.1 Plus
Dsec\GM20603-PA 372 GM20603-PA 74..349 4..281 394 33.1 Plus
Dsec\GM21120-PA 350 GM21120-PA 116..338 39..260 347 34.6 Plus
Dsec\GM22445-PA 341 GM22445-PA 7..269 10..279 313 32.6 Plus
Dsec\GM22093-PA 337 GM22093-PA 1..224 35..275 281 34.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:59:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15030-PA 279 GD15030-PA 1..267 1..267 1358 96.6 Plus
Dsim\GD10076-PA 372 GD10076-PA 74..349 4..281 391 33.1 Plus
Dsim\GD10653-PA 350 GD10653-PA 86..338 8..260 355 32.8 Plus
Dsim\GD15029-PA 341 GD15029-PA 7..269 10..279 317 33 Plus
Dsim\GD12067-PA 343 GD12067-PA 1..224 35..275 285 34.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:59:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11637-PA 306 GJ11637-PA 1..306 1..305 1246 75.8 Plus
Dvir\GJ18026-PA 378 GJ18026-PA 82..364 4..290 407 33.6 Plus
Dvir\GJ18273-PA 332 GJ18273-PA 86..305 39..260 364 35.7 Plus
Dvir\GJ11635-PA 345 GJ11635-PA 35..275 39..282 333 34 Plus
Dvir\GJ13711-PA 340 GJ13711-PA 1..238 35..294 275 30.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:59:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16760-PA 307 GK16760-PA 1..307 1..305 1189 74.9 Plus
Dwil\GK21745-PA 385 GK21745-PA 85..371 4..290 403 32.8 Plus
Dwil\GK21557-PA 361 GK21557-PA 92..349 6..260 344 31.6 Plus
Dwil\GK16759-PA 364 GK16759-PA 7..283 10..282 316 31.6 Plus
Dwil\GK16761-PA 362 GK16761-PA 50..309 8..275 289 32.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:59:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23018-PA 305 GE23018-PA 1..305 1..305 1502 92.8 Plus
Dyak\GE19505-PA 305 GE19505-PA 1..305 1..305 1496 92.5 Plus
Dyak\GE22302-PA 369 GE22302-PA 71..346 4..281 390 33.1 Plus
Dyak\GE19275-PA 354 GE19275-PA 90..342 8..260 357 32.2 Plus
Dyak\GE23017-PA 341 GE23017-PA 7..269 10..279 328 34.1 Plus