BDGP Sequence Production Resources |
Search the DGRC for RE35169
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 351 |
Well: | 69 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG15203-RA |
Protein status: | RE35169.pep: gold |
Preliminary Size: | 486 |
Sequenced Size: | 642 |
Gene | Date | Evidence |
---|---|---|
CG15203 | 2002-01-01 | Sim4 clustering to Release 2 |
CG15203 | 2003-01-01 | Sim4 clustering to Release 3 |
CG15203 | 2008-04-29 | Stopped prior to 5.5 |
CG15203-RA | 2009-01-21 | est gleaning |
642 bp assembled on 2010-01-18
GenBank Submission: BT120143.1
> RE35169.complete TGGGTCCAGTTTCGAACACCAAGGCGGTCGCAATGCATCCGGAACGCTAC GCCAGTCCAAATCCATTGATACCATTGGTAATCGCAGGCGCCCTGCTCTT CTCGATGCTCTCGCAGGTGAGCGGCTACTCGGGACGAATTCCACCGGATG CAGATAATCCCGGGAAGTGCATGTACCGCGGTGACGTCCTGGAACTGGGT GTCAACAATGGCATCGCTCCCTGCCAGCGACTGACTTGCAACAAGGATGG ATCAATACTTATCGAGGGTTGCGGCAAACTGCGCATCGAAAACTGCAACC GAGGCGAGCGAATCTCTCCGGGTGAACCCTTTCCGGAATGCTGCAAGCTG AGATACAAGTGCAAGCAAATCGGAGCGGCACCCTACTACATCGAGCGGAA TACGGCGGAGAAGGTCTAGTGGGATTAGCTGGGATTATGCAGGATTAGCC ACCGGGAGAAGAGGACCACCGAAGCCAAAGATGCAATGAATCTTTCTTAG TTGCAACGTACATATAATCAACAATTTGCTAATTTATTTGTCATCTTGTA CTTCTCAATAAGCACCATGTTTTGTTTTTTTTTTTTTTTTAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAGAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15203-RA | 1138 | CG15203-RA | 276..864 | 4..592 | 2930 | 99.8 | Plus |
CG15203.b | 1263 | CG15203.b | 693..1263 | 4..574 | 2840 | 99.8 | Plus |
CG15203.a | 490 | CG15203.a | 66..490 | 150..574 | 2110 | 99.7 | Plus |
CG15203.a | 490 | CG15203.a | 1..69 | 48..116 | 345 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 10959033..10959357 | 268..592 | 1610 | 99.7 | Plus |
chrX | 22417052 | chrX | 10957841..10957990 | 4..153 | 750 | 100 | Plus |
chrX | 22417052 | chrX | 10958071..10958188 | 151..268 | 590 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23527363 | X | 11075873..11076197 | 268..592 | 1610 | 99.6 | Plus |
X | 23527363 | X | 11074681..11074830 | 4..153 | 750 | 100 | Plus |
X | 23527363 | X | 11074911..11075028 | 151..268 | 590 | 100 | Plus |
3R | 31820162 | 3R | 30075762..30075819 | 580..637 | 200 | 89.6 | Plus |
3R | 31820162 | 3R | 30075762..30075819 | 579..636 | 185 | 87.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Fw2 | 3961 | Fw2 FW2 3961bp | 253..298 | 578..532 | 106 | 72.3 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 10957838..10957990 | 1..153 | 98 | -> | Plus |
chrX | 10958074..10958188 | 154..268 | 100 | -> | Plus |
chrX | 10959034..10959355 | 269..590 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15203-RA | 1..387 | 33..419 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15203-RA | 1..387 | 33..419 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15203-RA | 1..387 | 33..419 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15203-RA | 1..387 | 33..419 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15203-RA | 1..574 | 1..574 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15203-RA | 1..574 | 1..574 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15203-RA | 21..610 | 1..590 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15203-RB | 29..618 | 1..590 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 11066580..11066732 | 1..153 | 98 | -> | Plus |
X | 11066816..11066930 | 154..268 | 100 | -> | Plus |
X | 11067776..11068097 | 269..590 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 11066580..11066732 | 1..153 | 98 | -> | Plus |
X | 11066816..11066930 | 154..268 | 100 | -> | Plus |
X | 11067776..11068097 | 269..590 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 11066580..11066732 | 1..153 | 98 | -> | Plus |
X | 11066816..11066930 | 154..268 | 100 | -> | Plus |
X | 11067776..11068097 | 269..590 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 10960613..10960765 | 1..153 | 98 | -> | Plus |
arm_X | 10960849..10960963 | 154..268 | 100 | -> | Plus |
arm_X | 10961809..10962130 | 269..590 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 11075874..11076195 | 269..590 | 99 | Plus | |
X | 11074678..11074830 | 1..153 | 98 | -> | Plus |
X | 11074914..11075028 | 154..268 | 100 | -> | Plus |
Translation from 2 to 418
> RE35169.hyp SPVSNTKAVAMHPERYASPNPLIPLVIAGALLFSMLSQVSGYSGRIPPDA DNPGKCMYRGDVLELGVNNGIAPCQRLTCNKDGSILIEGCGKLRIENCNR GERISPGEPFPECCKLRYKCKQIGAAPYYIERNTAEKV*
Translation from 2 to 418
> RE35169.pep GPVSNTKAVAMHPERYASPNPLIPLVIAGALLFSMLSQVSGYSGRIPPDA DNPGKCMYRGDVLELGVNNGIAPCQRLTCNKDGSILIEGCGKLRIENCNR GERISPGEPFPECCKLRYKCKQIGAAPYYIERNTAEKV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF20288-PA | 131 | GF20288-PA | 1..123 | 11..135 | 415 | 65.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG18385-PA | 128 | GG18385-PA | 1..128 | 11..138 | 640 | 94.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH17918-PA | 133 | GH17918-PA | 32..130 | 37..135 | 341 | 60.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15203-PB | 128 | CG15203-PB | 1..128 | 11..138 | 697 | 100 | Plus |
CG15203-PA | 128 | CG15203-PA | 1..128 | 11..138 | 697 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI16061-PA | 139 | GI16061-PA | 6..137 | 5..136 | 375 | 58.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL18254-PA | 123 | GL18254-PA | 1..121 | 11..136 | 474 | 74.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13567-PA | 123 | GA13567-PA | 1..121 | 11..136 | 474 | 74.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM11451-PA | 128 | GM11451-PA | 1..128 | 11..138 | 650 | 96.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD16999-PA | 128 | GD16999-PA | 1..128 | 11..138 | 654 | 97.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ15633-PA | 134 | GJ15633-PA | 1..132 | 11..136 | 407 | 62.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19983-PA | 213 | GK19983-PA | 1..123 | 11..135 | 432 | 68.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE15902-PA | 128 | GE15902-PA | 1..128 | 11..138 | 647 | 96.9 | Plus |