Clone RE35245 Report

Search the DGRC for RE35245

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:352
Well:45
Vector:pFlc-1
Associated Gene/TranscriptAP-2sigma-RA
Protein status:RE35245.pep: gold
Sequenced Size:743

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6056 2002-01-01 Sim4 clustering to Release 2
CG6056 2003-01-01 Sim4 clustering to Release 3
CG6056 2003-08-11 Blastp of sequenced clone
AP-2sigma 2008-04-29 Release 5.5 accounting
AP-2sigma 2008-08-15 Release 5.9 accounting
AP-2sigma 2008-12-18 5.12 accounting

Clone Sequence Records

RE35245.complete Sequence

743 bp (743 high quality bases) assembled on 2003-08-11

GenBank Submission: BT010252

> RE35245.complete
AGTGATACACAATTTGCTCATAATCAGTTTTTCGCCCCCATTCTCGAAAC
AAAAAAAGTTGTAAATAAGCAGGAAACGGTTTAACCAATTTCCCGAAAAA
TGATACGATTCATACTTATACAAAACCGAGCTGGAAAAACTCGCCTGGCC
AAGTGGTATATGAACTTCGATGACGACGAGAAGCAGAAACTGATTGAGGA
GGTGCATGCCGTGGTCACAGTGCGCGATGCCAAGCACACCAACTTTGTGG
AGTTCCGCAACTTCAAGATCGTCTACCGACGCTATGCGGGTCTGTACTTC
TGCATCTGCGTGGACGTAAACGACAACAACCTGTGCTATCTGGAGGCCAT
TCACAACTTCGTGGAGGTGCTCAACGAATACTTCCATAATGTGTGCGAGC
TGGATCTGGTCTTCAACTTCTACAAGGTGTACAGTGTGGTGGACGAGATG
TTCCTGGCGGGCGAGATCCGGGAGACCTCGCAGACGAAGGTGCTCAAGCA
GCTGCTCACGCTAAATTCGCTGGAGTAGCGGCCCAATTCATACATATGTA
TATCGGATCTGCCAGATGCATTCCCCCAGGCGCTACACCCGCCTATCGAA
TCTTCTTTCATATACTATTACGCGTATTATTATTATTATCTTTAATGTGT
TCTCTATGCAAACACTCAAATGTTAAAGGCCGTGTTTAGAAACAAATGAT
GTACCATAAGAGATTGTATGCAAAAGTTAAAAAAAAAAAAAAA

RE35245.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:31:49
Subject Length Description Subject Range Query Range Score Percent Strand
AP-2sigma-RA 829 AP-2sigma-RA 33..762 1..730 3650 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:32:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 17093038..17093515 728..251 2390 100 Minus
chr3R 27901430 chr3R 17093574..17093724 252..102 755 100 Minus
chr3R 27901430 chr3R 17093780..17093881 102..1 510 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:51:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:32:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21269207..21269686 730..251 2400 100 Minus
3R 32079331 3R 21269745..21269895 252..102 755 100 Minus
3R 32079331 3R 21269951..21270052 102..1 510 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:00:02
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 21010038..21010517 730..251 2400 100 Minus
3R 31820162 3R 21010576..21010726 252..102 755 100 Minus
3R 31820162 3R 21010782..21010883 102..1 510 100 Minus
Blast to na_te.dros performed 2019-03-16 05:32:48
Subject Length Description Subject Range Query Range Score Percent Strand
accord2 7650 accord2 QBERT 7650bp 6244..6360 591..708 118 61.2 Plus
invader6 4885 invader6 INVADER6 4885bp 4379..4422 652..610 109 75 Minus

RE35245.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:33:58 Download gff for RE35245.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 17093574..17093723 103..252 100 <- Minus
chr3R 17093780..17093881 1..102 100   Minus
chr3R 17093038..17093513 253..728 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:11:48 Download gff for RE35245.complete
Subject Subject Range Query Range Percent Splice Strand
AP-2sigma-RA 1..429 100..528 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:52:18 Download gff for RE35245.complete
Subject Subject Range Query Range Percent Splice Strand
AP-2sigma-RA 1..429 100..528 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:27:57 Download gff for RE35245.complete
Subject Subject Range Query Range Percent Splice Strand
AP-2sigma-RA 1..429 100..528 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:18:09 Download gff for RE35245.complete
Subject Subject Range Query Range Percent Splice Strand
AP-2sigma-RA 1..429 100..528 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:05:13 Download gff for RE35245.complete
Subject Subject Range Query Range Percent Splice Strand
AP-2sigma-RA 1..429 100..528 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:15:55 Download gff for RE35245.complete
Subject Subject Range Query Range Percent Splice Strand
AP-2sigma-RA 26..753 1..728 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:52:18 Download gff for RE35245.complete
Subject Subject Range Query Range Percent Splice Strand
AP-2sigma-RA 26..753 1..728 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:27:57 Download gff for RE35245.complete
Subject Subject Range Query Range Percent Splice Strand
AP-2sigma-RA 24..751 1..728 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:18:09 Download gff for RE35245.complete
Subject Subject Range Query Range Percent Splice Strand
AP-2sigma-RA 26..753 1..728 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:05:13 Download gff for RE35245.complete
Subject Subject Range Query Range Percent Splice Strand
AP-2sigma-RA 24..751 1..728 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:33:58 Download gff for RE35245.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21269745..21269894 103..252 100 <- Minus
3R 21269951..21270052 1..102 100   Minus
3R 21269209..21269684 253..728 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:33:58 Download gff for RE35245.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21269745..21269894 103..252 100 <- Minus
3R 21269951..21270052 1..102 100   Minus
3R 21269209..21269684 253..728 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:33:58 Download gff for RE35245.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21269745..21269894 103..252 100 <- Minus
3R 21269951..21270052 1..102 100   Minus
3R 21269209..21269684 253..728 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:27:57 Download gff for RE35245.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17095673..17095774 1..102 100   Minus
arm_3R 17094931..17095406 253..728 100 <- Minus
arm_3R 17095467..17095616 103..252 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:52:19 Download gff for RE35245.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21010040..21010515 253..728 100 <- Minus
3R 21010576..21010725 103..252 100 <- Minus
3R 21010782..21010883 1..102 100   Minus

RE35245.pep Sequence

Translation from 99 to 527

> RE35245.pep
MIRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAKHTNFV
EFRNFKIVYRRYAGLYFCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCE
LDLVFNFYKVYSVVDEMFLAGEIRETSQTKVLKQLLTLNSLE*

RE35245.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:11:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17262-PA 142 GF17262-PA 1..142 1..142 740 100 Plus
Dana\GF17027-PA 156 GF17027-PA 3..141 4..142 360 46.8 Plus
Dana\GF12884-PA 191 GF12884-PA 1..147 1..141 263 37.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:11:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14749-PA 142 GG14749-PA 1..142 1..142 740 100 Plus
Dere\GG11239-PA 156 GG11239-PA 3..141 4..142 360 46.8 Plus
Dere\GG22912-PA 191 GG22912-PA 1..147 1..141 260 36.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:11:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18926-PA 122 GH18926-PA 1..122 21..142 628 100 Plus
Dgri\GH11883-PA 156 GH11883-PA 3..141 4..142 363 46.8 Plus
Dgri\GH21700-PA 191 GH21700-PA 1..147 1..141 262 37.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:57
Subject Length Description Subject Range Query Range Score Percent Strand
AP-2sigma-PA 142 CG6056-PA 1..142 1..142 745 100 Plus
AP-1sigma-PD 152 CG5864-PD 1..142 1..142 366 46.5 Plus
AP-1sigma-PC 157 CG5864-PC 1..142 1..142 366 46.5 Plus
AP-1sigma-PB 157 CG5864-PB 1..142 1..142 366 46.5 Plus
AP-1sigma-PA 157 CG5864-PA 1..142 1..142 366 46.5 Plus
or-PA 191 CG3029-PA 1..147 1..141 269 36.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:11:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10836-PA 141 GI10836-PA 1..141 2..142 733 100 Plus
Dmoj\GI24137-PA 157 GI24137-PA 1..142 1..142 368 46.5 Plus
Dmoj\GI20707-PA 191 GI20707-PA 1..147 1..141 262 37.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:11:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27163-PA 142 GL27163-PA 1..142 1..142 740 100 Plus
Dper\GL23383-PA 157 GL23383-PA 1..142 1..142 365 46.5 Plus
Dper\GL11643-PA 191 GL11643-PA 1..147 1..141 261 36.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:11:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19327-PA 142 GA19327-PA 1..142 1..142 740 100 Plus
Dpse\GA19188-PA 157 GA19188-PA 1..142 1..142 365 46.5 Plus
Dpse\GA15753-PA 191 GA15753-PA 1..147 1..141 261 36.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:11:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15088-PA 142 GM15088-PA 1..142 1..142 740 100 Plus
Dsec\GM26541-PA 156 GM26541-PA 3..141 4..142 360 46.8 Plus
Dsec\GM16073-PA 188 GM16073-PA 1..141 1..135 261 37.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:11:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19995-PA 142 GD19995-PA 1..142 1..142 740 100 Plus
Dsim\GD21048-PA 156 GD21048-PA 3..141 4..142 360 46.8 Plus
Dsim\GD11816-PA 191 GD11816-PA 1..147 1..141 260 36.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:11:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14442-PA 142 GJ14442-PA 1..142 1..142 740 100 Plus
Dvir\GJ24652-PA 156 GJ24652-PA 3..141 4..142 363 46.8 Plus
Dvir\GJ19697-PA 191 GJ19697-PA 1..147 1..141 262 37.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:11:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12771-PA 142 GK12771-PA 1..142 1..142 740 100 Plus
Dwil\GK11486-PA 156 GK11486-PA 3..141 4..142 360 46.8 Plus
Dwil\GK15725-PA 191 GK15725-PA 1..147 1..141 263 37.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:11:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\AP-2sigma-PA 142 GE25002-PA 1..142 1..142 740 100 Plus
Dyak\GE23431-PA 156 GE23431-PA 3..141 4..142 360 46.8 Plus
Dyak\GE14351-PA 191 GE14351-PA 1..147 1..141 260 36.7 Plus

RE35245.hyp Sequence

Translation from 99 to 527

> RE35245.hyp
MIRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAKHTNFV
EFRNFKIVYRRYAGLYFCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCE
LDLVFNFYKVYSVVDEMFLAGEIRETSQTKVLKQLLTLNSLE*

RE35245.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:00:49
Subject Length Description Subject Range Query Range Score Percent Strand
AP-2sigma-PA 142 CG6056-PA 1..142 1..142 745 100 Plus
AP-1sigma-PD 152 CG5864-PD 1..142 1..142 366 46.5 Plus
AP-1sigma-PC 157 CG5864-PC 1..142 1..142 366 46.5 Plus
AP-1sigma-PB 157 CG5864-PB 1..142 1..142 366 46.5 Plus
AP-1sigma-PA 157 CG5864-PA 1..142 1..142 366 46.5 Plus