BDGP Sequence Production Resources |
Search the DGRC for RE35245
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 352 |
Well: | 45 |
Vector: | pFlc-1 |
Associated Gene/Transcript | AP-2sigma-RA |
Protein status: | RE35245.pep: gold |
Sequenced Size: | 743 |
Gene | Date | Evidence |
---|---|---|
CG6056 | 2002-01-01 | Sim4 clustering to Release 2 |
CG6056 | 2003-01-01 | Sim4 clustering to Release 3 |
CG6056 | 2003-08-11 | Blastp of sequenced clone |
AP-2sigma | 2008-04-29 | Release 5.5 accounting |
AP-2sigma | 2008-08-15 | Release 5.9 accounting |
AP-2sigma | 2008-12-18 | 5.12 accounting |
743 bp (743 high quality bases) assembled on 2003-08-11
GenBank Submission: BT010252
> RE35245.complete AGTGATACACAATTTGCTCATAATCAGTTTTTCGCCCCCATTCTCGAAAC AAAAAAAGTTGTAAATAAGCAGGAAACGGTTTAACCAATTTCCCGAAAAA TGATACGATTCATACTTATACAAAACCGAGCTGGAAAAACTCGCCTGGCC AAGTGGTATATGAACTTCGATGACGACGAGAAGCAGAAACTGATTGAGGA GGTGCATGCCGTGGTCACAGTGCGCGATGCCAAGCACACCAACTTTGTGG AGTTCCGCAACTTCAAGATCGTCTACCGACGCTATGCGGGTCTGTACTTC TGCATCTGCGTGGACGTAAACGACAACAACCTGTGCTATCTGGAGGCCAT TCACAACTTCGTGGAGGTGCTCAACGAATACTTCCATAATGTGTGCGAGC TGGATCTGGTCTTCAACTTCTACAAGGTGTACAGTGTGGTGGACGAGATG TTCCTGGCGGGCGAGATCCGGGAGACCTCGCAGACGAAGGTGCTCAAGCA GCTGCTCACGCTAAATTCGCTGGAGTAGCGGCCCAATTCATACATATGTA TATCGGATCTGCCAGATGCATTCCCCCAGGCGCTACACCCGCCTATCGAA TCTTCTTTCATATACTATTACGCGTATTATTATTATTATCTTTAATGTGT TCTCTATGCAAACACTCAAATGTTAAAGGCCGTGTTTAGAAACAAATGAT GTACCATAAGAGATTGTATGCAAAAGTTAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
AP-2sigma-RA | 829 | AP-2sigma-RA | 33..762 | 1..730 | 3650 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 17093038..17093515 | 728..251 | 2390 | 100 | Minus |
chr3R | 27901430 | chr3R | 17093574..17093724 | 252..102 | 755 | 100 | Minus |
chr3R | 27901430 | chr3R | 17093780..17093881 | 102..1 | 510 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 21269207..21269686 | 730..251 | 2400 | 100 | Minus |
3R | 32079331 | 3R | 21269745..21269895 | 252..102 | 755 | 100 | Minus |
3R | 32079331 | 3R | 21269951..21270052 | 102..1 | 510 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 21010038..21010517 | 730..251 | 2400 | 100 | Minus |
3R | 31820162 | 3R | 21010576..21010726 | 252..102 | 755 | 100 | Minus |
3R | 31820162 | 3R | 21010782..21010883 | 102..1 | 510 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 17093574..17093723 | 103..252 | 100 | <- | Minus |
chr3R | 17093780..17093881 | 1..102 | 100 | Minus | |
chr3R | 17093038..17093513 | 253..728 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
AP-2sigma-RA | 1..429 | 100..528 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
AP-2sigma-RA | 1..429 | 100..528 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
AP-2sigma-RA | 1..429 | 100..528 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
AP-2sigma-RA | 1..429 | 100..528 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
AP-2sigma-RA | 1..429 | 100..528 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
AP-2sigma-RA | 26..753 | 1..728 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
AP-2sigma-RA | 26..753 | 1..728 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
AP-2sigma-RA | 24..751 | 1..728 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
AP-2sigma-RA | 26..753 | 1..728 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
AP-2sigma-RA | 24..751 | 1..728 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 21269745..21269894 | 103..252 | 100 | <- | Minus |
3R | 21269951..21270052 | 1..102 | 100 | Minus | |
3R | 21269209..21269684 | 253..728 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 21269745..21269894 | 103..252 | 100 | <- | Minus |
3R | 21269951..21270052 | 1..102 | 100 | Minus | |
3R | 21269209..21269684 | 253..728 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 21269745..21269894 | 103..252 | 100 | <- | Minus |
3R | 21269951..21270052 | 1..102 | 100 | Minus | |
3R | 21269209..21269684 | 253..728 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 17095673..17095774 | 1..102 | 100 | Minus | |
arm_3R | 17094931..17095406 | 253..728 | 100 | <- | Minus |
arm_3R | 17095467..17095616 | 103..252 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 21010040..21010515 | 253..728 | 100 | <- | Minus |
3R | 21010576..21010725 | 103..252 | 100 | <- | Minus |
3R | 21010782..21010883 | 1..102 | 100 | Minus |
Translation from 99 to 527
> RE35245.pep MIRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAKHTNFV EFRNFKIVYRRYAGLYFCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCE LDLVFNFYKVYSVVDEMFLAGEIRETSQTKVLKQLLTLNSLE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF17262-PA | 142 | GF17262-PA | 1..142 | 1..142 | 740 | 100 | Plus |
Dana\GF17027-PA | 156 | GF17027-PA | 3..141 | 4..142 | 360 | 46.8 | Plus |
Dana\GF12884-PA | 191 | GF12884-PA | 1..147 | 1..141 | 263 | 37.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14749-PA | 142 | GG14749-PA | 1..142 | 1..142 | 740 | 100 | Plus |
Dere\GG11239-PA | 156 | GG11239-PA | 3..141 | 4..142 | 360 | 46.8 | Plus |
Dere\GG22912-PA | 191 | GG22912-PA | 1..147 | 1..141 | 260 | 36.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18926-PA | 122 | GH18926-PA | 1..122 | 21..142 | 628 | 100 | Plus |
Dgri\GH11883-PA | 156 | GH11883-PA | 3..141 | 4..142 | 363 | 46.8 | Plus |
Dgri\GH21700-PA | 191 | GH21700-PA | 1..147 | 1..141 | 262 | 37.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
AP-2sigma-PA | 142 | CG6056-PA | 1..142 | 1..142 | 745 | 100 | Plus |
AP-1sigma-PD | 152 | CG5864-PD | 1..142 | 1..142 | 366 | 46.5 | Plus |
AP-1sigma-PC | 157 | CG5864-PC | 1..142 | 1..142 | 366 | 46.5 | Plus |
AP-1sigma-PB | 157 | CG5864-PB | 1..142 | 1..142 | 366 | 46.5 | Plus |
AP-1sigma-PA | 157 | CG5864-PA | 1..142 | 1..142 | 366 | 46.5 | Plus |
or-PA | 191 | CG3029-PA | 1..147 | 1..141 | 269 | 36.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10836-PA | 141 | GI10836-PA | 1..141 | 2..142 | 733 | 100 | Plus |
Dmoj\GI24137-PA | 157 | GI24137-PA | 1..142 | 1..142 | 368 | 46.5 | Plus |
Dmoj\GI20707-PA | 191 | GI20707-PA | 1..147 | 1..141 | 262 | 37.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL27163-PA | 142 | GL27163-PA | 1..142 | 1..142 | 740 | 100 | Plus |
Dper\GL23383-PA | 157 | GL23383-PA | 1..142 | 1..142 | 365 | 46.5 | Plus |
Dper\GL11643-PA | 191 | GL11643-PA | 1..147 | 1..141 | 261 | 36.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA19327-PA | 142 | GA19327-PA | 1..142 | 1..142 | 740 | 100 | Plus |
Dpse\GA19188-PA | 157 | GA19188-PA | 1..142 | 1..142 | 365 | 46.5 | Plus |
Dpse\GA15753-PA | 191 | GA15753-PA | 1..147 | 1..141 | 261 | 36.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15088-PA | 142 | GM15088-PA | 1..142 | 1..142 | 740 | 100 | Plus |
Dsec\GM26541-PA | 156 | GM26541-PA | 3..141 | 4..142 | 360 | 46.8 | Plus |
Dsec\GM16073-PA | 188 | GM16073-PA | 1..141 | 1..135 | 261 | 37.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD19995-PA | 142 | GD19995-PA | 1..142 | 1..142 | 740 | 100 | Plus |
Dsim\GD21048-PA | 156 | GD21048-PA | 3..141 | 4..142 | 360 | 46.8 | Plus |
Dsim\GD11816-PA | 191 | GD11816-PA | 1..147 | 1..141 | 260 | 36.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ14442-PA | 142 | GJ14442-PA | 1..142 | 1..142 | 740 | 100 | Plus |
Dvir\GJ24652-PA | 156 | GJ24652-PA | 3..141 | 4..142 | 363 | 46.8 | Plus |
Dvir\GJ19697-PA | 191 | GJ19697-PA | 1..147 | 1..141 | 262 | 37.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK12771-PA | 142 | GK12771-PA | 1..142 | 1..142 | 740 | 100 | Plus |
Dwil\GK11486-PA | 156 | GK11486-PA | 3..141 | 4..142 | 360 | 46.8 | Plus |
Dwil\GK15725-PA | 191 | GK15725-PA | 1..147 | 1..141 | 263 | 37.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\AP-2sigma-PA | 142 | GE25002-PA | 1..142 | 1..142 | 740 | 100 | Plus |
Dyak\GE23431-PA | 156 | GE23431-PA | 3..141 | 4..142 | 360 | 46.8 | Plus |
Dyak\GE14351-PA | 191 | GE14351-PA | 1..147 | 1..141 | 260 | 36.7 | Plus |
Translation from 99 to 527
> RE35245.hyp MIRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAKHTNFV EFRNFKIVYRRYAGLYFCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCE LDLVFNFYKVYSVVDEMFLAGEIRETSQTKVLKQLLTLNSLE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
AP-2sigma-PA | 142 | CG6056-PA | 1..142 | 1..142 | 745 | 100 | Plus |
AP-1sigma-PD | 152 | CG5864-PD | 1..142 | 1..142 | 366 | 46.5 | Plus |
AP-1sigma-PC | 157 | CG5864-PC | 1..142 | 1..142 | 366 | 46.5 | Plus |
AP-1sigma-PB | 157 | CG5864-PB | 1..142 | 1..142 | 366 | 46.5 | Plus |
AP-1sigma-PA | 157 | CG5864-PA | 1..142 | 1..142 | 366 | 46.5 | Plus |