Clone RE35371 Report

Search the DGRC for RE35371

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:353
Well:71
Vector:pFlc-1
Associated Gene/TranscriptCG14153-RA
Protein status:RE35371.pep: gold
Preliminary Size:714
Sequenced Size:1034

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14153 2002-01-01 Sim4 clustering to Release 2
CG14153 2002-02-22 Blastp of sequenced clone
CG14153 2003-01-01 Sim4 clustering to Release 3
CG14153 2008-04-29 Release 5.5 accounting
CG14153 2008-08-15 Release 5.9 accounting
CG14153 2008-12-18 5.12 accounting

Clone Sequence Records

RE35371.complete Sequence

1034 bp (1034 high quality bases) assembled on 2002-02-22

GenBank Submission: AY089620

> RE35371.complete
ACGGTCAGAAATGAAGCCGCAAACAGGACGGATCGTGAAGAGCAGCTCGT
CGAGCTGGCTATGTGCACTTATGCCCCTGATGATCGATGCAGTTTGTGGG
AGAGCTCAGTATGCATCACCTTATGGCAGTGCTTATGCAATTACCACATC
CAACTACGCTCAATCCAACTATGCCAATCCAGATGTACAATCGATATGGT
CGGGTCCGCCTATCATAGTGAATGATAATCAGTACAGTGCCCAGGAACAG
CAGCAGTATCCAAAAAGTAATGGTTATTATGTTGCGGAACCTGCGTATAG
ACAAGCATATCCAAATTGGAGAAGGGAAGACCCAACACATGCTCCCAATC
ACAACTATAACAATGTGCCCGGCTACTTTTACTATCAACAACAGGAGACT
ACGCCATCAACACCTCTGCGCTATCCTCAATCTCAAATTCCACCTCAACT
TCAGCCATATCCACAAAGGAATCCGGAATTGGAGACCAGCGATTCGGGTC
GCGATGAGGAGCAAGTGGTCCAAATTGGCGGCAGTCGCTCATTGGCCACA
AATAACTATCTAAATACGTACAATAATAAGGAGAATTTCTATGAACCCGC
TCAGCCCTGGAGGCGTCGTGATTACCAGGCCAAATATGCCCAACATTTTG
CCGAATATTTGCGTAAATATCCAAGACGCCTGCAGCCAGTTTACAACACC
AACGAGGATTTTGTTGAAAAGTAGGGGAATACTCTGCATTTGACTTTGCA
TCAAAAAACATATTGAATAAATCCCCTCAAGAGCCATTAGCAATTTTCGT
TGAAAGCGTGCCAAGAAAACTATTTCTGTCTGTACTCGGAACAGATCAAT
TGCATCCGATAAAGATACAGATTGCAGCTGCTGTAGAGTCAACATGCCAA
CACAGTAAATATTGGTTTATCCCTTTAAAAGGCAAGAATAATAATAATTG
TATGTAACAAAACTATGCTTAGTTAGTTCCGTAAGAGATACACAACAATA
AAAGTTATTTTCAGAAGGAAAAAAAAAAAAAAAA

RE35371.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:25:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG14153-RA 1191 CG14153-RA 178..1191 4..1017 5070 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:56:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 10635035..10635990 58..1013 4585 98.6 Plus
chr3L 24539361 chr3L 10634925..10634979 4..58 260 98.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:51:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:56:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 10643656..10644615 58..1017 4800 100 Plus
3L 28110227 3L 10643536..10643590 4..58 275 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:54:35
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 10636756..10637715 58..1017 4800 100 Plus
3L 28103327 3L 10636636..10636690 4..58 275 100 Plus
Blast to na_te.dros performed on 2019-03-16 04:56:56 has no hits.

RE35371.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:57:39 Download gff for RE35371.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 10634922..10634979 1..58 96 -> Plus
chr3L 10635036..10635995 59..1018 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:11:53 Download gff for RE35371.complete
Subject Subject Range Query Range Percent Splice Strand
CG14153-RA 1..714 11..724 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:38:31 Download gff for RE35371.complete
Subject Subject Range Query Range Percent Splice Strand
CG14153-RA 1..714 11..724 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:46:29 Download gff for RE35371.complete
Subject Subject Range Query Range Percent Splice Strand
CG14153-RA 1..714 11..724 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:08:53 Download gff for RE35371.complete
Subject Subject Range Query Range Percent Splice Strand
CG14153-RA 1..714 11..724 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:55:07 Download gff for RE35371.complete
Subject Subject Range Query Range Percent Splice Strand
CG14153-RA 1..714 11..724 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:03:35 Download gff for RE35371.complete
Subject Subject Range Query Range Percent Splice Strand
CG14153-RA 1..1017 1..1017 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:38:30 Download gff for RE35371.complete
Subject Subject Range Query Range Percent Splice Strand
CG14153-RA 1..1017 1..1017 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:46:29 Download gff for RE35371.complete
Subject Subject Range Query Range Percent Splice Strand
CG14153-RA 6..1022 1..1017 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:08:53 Download gff for RE35371.complete
Subject Subject Range Query Range Percent Splice Strand
CG14153-RA 1..1017 1..1017 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:55:07 Download gff for RE35371.complete
Subject Subject Range Query Range Percent Splice Strand
CG14153-RA 6..1022 1..1017 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:57:39 Download gff for RE35371.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10643533..10643590 1..58 98 -> Plus
3L 10643657..10644615 59..1018 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:57:39 Download gff for RE35371.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10643533..10643590 1..58 98 -> Plus
3L 10643657..10644615 59..1018 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:57:39 Download gff for RE35371.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10643533..10643590 1..58 98 -> Plus
3L 10643657..10644615 59..1018 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:46:29 Download gff for RE35371.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 10636633..10636690 1..58 98 -> Plus
arm_3L 10636757..10637715 59..1018 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:43:01 Download gff for RE35371.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10636757..10637715 59..1018 99   Plus
3L 10636633..10636690 1..58 98 -> Plus

RE35371.hyp Sequence

Translation from 0 to 723

> RE35371.hyp
QSEMKPQTGRIVKSSSSSWLCALMPLMIDAVCGRAQYASPYGSAYAITTS
NYAQSNYANPDVQSIWSGPPIIVNDNQYSAQEQQQYPKSNGYYVAEPAYR
QAYPNWRREDPTHAPNHNYNNVPGYFYYQQQETTPSTPLRYPQSQIPPQL
QPYPQRNPELETSDSGRDEEQVVQIGGSRSLATNNYLNTYNNKENFYEPA
QPWRRRDYQAKYAQHFAEYLRKYPRRLQPVYNTNEDFVEK*

RE35371.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:51:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG14153-PA 237 CG14153-PA 1..237 4..240 1300 100 Plus

RE35371.pep Sequence

Translation from 10 to 723

> RE35371.pep
MKPQTGRIVKSSSSSWLCALMPLMIDAVCGRAQYASPYGSAYAITTSNYA
QSNYANPDVQSIWSGPPIIVNDNQYSAQEQQQYPKSNGYYVAEPAYRQAY
PNWRREDPTHAPNHNYNNVPGYFYYQQQETTPSTPLRYPQSQIPPQLQPY
PQRNPELETSDSGRDEEQVVQIGGSRSLATNNYLNTYNNKENFYEPAQPW
RRRDYQAKYAQHFAEYLRKYPRRLQPVYNTNEDFVEK*

RE35371.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:07:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10602-PA 358 GF10602-PA 159..358 24..237 575 60.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:07:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15445-PA 231 GG15445-PA 1..231 1..237 966 85.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:07:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14953-PA 116 GH14953-PA 3..116 111..237 280 48.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG14153-PA 237 CG14153-PA 1..237 1..237 1300 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:07:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11480-PA 224 GI11480-PA 48..224 59..237 198 39.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:07:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15476-PA 296 GL15476-PA 25..296 17..237 467 47.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:07:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12791-PA 304 GA12791-PA 25..304 17..237 471 47 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:07:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25220-PA 236 GM25220-PA 1..236 1..237 1068 92.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:07:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14253-PA 231 GD14253-PA 1..231 1..237 1030 91.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:07:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13674-PA 242 GJ13674-PA 19..242 16..237 255 35.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:07:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21756-PA 235 GE21756-PA 1..235 1..237 940 84.6 Plus