BDGP Sequence Production Resources |
Search the DGRC for RE35615
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 356 |
Well: | 15 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG14570-RA |
Protein status: | RE35615.pep: gold |
Preliminary Size: | 687 |
Sequenced Size: | 804 |
Gene | Date | Evidence |
---|---|---|
CG14570 | 2002-01-01 | Sim4 clustering to Release 2 |
CG14570 | 2002-03-28 | Blastp of sequenced clone |
CG14570 | 2003-01-01 | Sim4 clustering to Release 3 |
CG14570 | 2008-04-29 | Release 5.5 accounting |
CG14570 | 2008-08-15 | Release 5.9 accounting |
CG14570 | 2008-12-18 | 5.12 accounting |
804 bp (804 high quality bases) assembled on 2002-03-28
GenBank Submission: AY094868
> RE35615.complete AGTTCATGTCAGCACACCACAATGTCCGGTTATCCAAGTGCTTCTCTGGT CACCTTTGCGCTTTGTTCCATTCTTTGCCTGAATGGAATTGAAGGCAGTC ATCTGAGGTTCCCAGGACCCGCGGCGGGAAGGTTTCTGCAAAGACAGGAA CAAGCCCCATATCCACCAGCAGGCCTGGTCCCCGATCCGCCATTCGACCT GCCAACGGAGGAGGCGGTTGAATTTCCTCAACCGGAGGATACATATGGCC CTCCACCTGAAACATACGGACCACCGTCTTTGGTGGAAGCGCCAGCTGAG GTCTACGGCCCACCGGACCAAATTTATGGACCTCCCGATCAGACCTACGG ACCTCCAGACCAGCCAGCCAATGATGACAGCTCCAACACATTGCCACAAA GCGCAGCTATAATTAATTTGGCAAGTCTGCCGCTACCACCCCAGGCTCAG TATGTTCTGCCGCTTCTGAACCGACTTTCTGCCTTCCGCCCGCAGCGTCC GGTTCTGCGGACTCCGCAGCGACGGCCGGCTAAGCTTACGGTTCGTCGTC GGCCAGATGCGGTCAAGATTGTGAATGCTATTAGGCCTACTCCAGTGTTC CCATCGACTCCGCAGGCTTTGCCCTTCGTGGATCGCCACATTCCTTTTCG CCCACGGCCATCTCGCCTGATAGTCAATGCGCCTTTCAGACGCCCATCCA GGCAATAGACTACTTCTTTCAGCACTCCAAGCAATGTCATGAATACACTG TAAATAAAGTTTGTTGTCTATGTCTAAAAAATAAAAAAAGAAAAAAAAAA AAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 21718608..21719384 | 777..1 | 3885 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 21729673..21730449 | 777..1 | 3885 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 21722773..21723549 | 777..1 | 3885 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 21718608..21719384 | 1..777 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14570-RA | 1..687 | 22..708 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14570-RA | 1..687 | 22..708 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14570-RA | 1..687 | 22..708 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14570-RA | 1..687 | 22..708 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14570-RA | 1..687 | 22..708 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14570-RA | 1..780 | 1..780 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14570-RA | 1..775 | 1..775 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14570-RA | 6..780 | 1..775 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14570-RA | 1..780 | 1..780 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14570-RA | 6..780 | 1..775 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21729673..21730449 | 1..777 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21729673..21730449 | 1..777 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21729673..21730449 | 1..777 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 21722773..21723549 | 1..777 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21722773..21723549 | 1..777 | 100 | Minus |
Translation from 0 to 707
> RE35615.hyp SSCQHTTMSGYPSASLVTFALCSILCLNGIEGSHLRFPGPAAGRFLQRQE QAPYPPAGLVPDPPFDLPTEEAVEFPQPEDTYGPPPETYGPPSLVEAPAE VYGPPDQIYGPPDQTYGPPDQPANDDSSNTLPQSAAIINLASLPLPPQAQ YVLPLLNRLSAFRPQRPVLRTPQRRPAKLTVRRRPDAVKIVNAIRPTPVF PSTPQALPFVDRHIPFRPRPSRLIVNAPFRRPSRQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14570-PA | 228 | CG14570-PA | 1..228 | 8..235 | 1221 | 100 | Plus |
CG14568-PA | 171 | CG14568-PA | 6..159 | 21..173 | 199 | 33.7 | Plus |
CG14569-PA | 195 | CG14569-PA | 4..111 | 12..134 | 183 | 36.1 | Plus |
Translation from 21 to 707
> RE35615.pep MSGYPSASLVTFALCSILCLNGIEGSHLRFPGPAAGRFLQRQEQAPYPPA GLVPDPPFDLPTEEAVEFPQPEDTYGPPPETYGPPSLVEAPAEVYGPPDQ IYGPPDQTYGPPDQPANDDSSNTLPQSAAIINLASLPLPPQAQYVLPLLN RLSAFRPQRPVLRTPQRRPAKLTVRRRPDAVKIVNAIRPTPVFPSTPQAL PFVDRHIPFRPRPSRLIVNAPFRRPSRQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24641-PA | 239 | GF24641-PA | 1..234 | 1..224 | 763 | 70.3 | Plus |
Dana\GF24639-PA | 179 | GF24639-PA | 7..179 | 15..184 | 159 | 35.4 | Plus |
Dana\GF24640-PA | 186 | GF24640-PA | 4..92 | 13..114 | 152 | 43.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG13207-PA | 228 | GG13207-PA | 1..228 | 1..228 | 1017 | 88.2 | Plus |
Dere\GG13205-PA | 171 | GG13205-PA | 62..130 | 45..127 | 145 | 44.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15096-PA | 257 | GH15096-PA | 20..219 | 25..224 | 401 | 53.6 | Plus |
Dgri\GH15094-PA | 180 | GH15094-PA | 61..120 | 45..112 | 144 | 57.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14570-PA | 228 | CG14570-PA | 1..228 | 1..228 | 1221 | 100 | Plus |
CG14568-PA | 171 | CG14568-PA | 6..159 | 14..166 | 199 | 33.7 | Plus |
CG14569-PA | 195 | CG14569-PA | 4..111 | 5..127 | 183 | 36.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13745-PA | 265 | GI13745-PA | 21..224 | 24..224 | 450 | 54.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL25277-PA | 127 | GL25277-PA | 1..71 | 1..68 | 178 | 57.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13089-PA | 225 | GA13089-PA | 1..225 | 1..228 | 739 | 68.7 | Plus |
Dpse\GA13088-PA | 196 | GA13088-PA | 4..95 | 5..112 | 144 | 39.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM22116-PA | 228 | GM22116-PA | 1..228 | 1..228 | 1057 | 92.1 | Plus |
Dsec\GM22114-PA | 171 | GM22114-PA | 62..159 | 45..166 | 142 | 39.3 | Plus |
Dsec\GM22115-PA | 195 | GM22115-PA | 4..94 | 5..113 | 140 | 37.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD12093-PA | 228 | GD12093-PA | 1..228 | 1..228 | 1067 | 93.4 | Plus |
Dsim\GD12091-PA | 171 | GD12091-PA | 62..159 | 45..166 | 149 | 40.2 | Plus |
Dsim\GD12092-PA | 195 | GD12092-PA | 4..94 | 5..113 | 140 | 37.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ14091-PA | 261 | GJ14091-PA | 22..220 | 25..224 | 459 | 57.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK17127-PA | 230 | GK17127-PA | 1..226 | 1..224 | 458 | 52 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE22987-PA | 220 | GE22987-PA | 1..220 | 1..228 | 937 | 83.3 | Plus |
Dyak\GE22985-PA | 171 | GE22985-PA | 6..114 | 14..117 | 156 | 37.2 | Plus |
Dyak\GE22299-PA | 171 | GE22299-PA | 6..114 | 14..117 | 156 | 37.2 | Plus |