Clone RE35615 Report

Search the DGRC for RE35615

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:356
Well:15
Vector:pFlc-1
Associated Gene/TranscriptCG14570-RA
Protein status:RE35615.pep: gold
Preliminary Size:687
Sequenced Size:804

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14570 2002-01-01 Sim4 clustering to Release 2
CG14570 2002-03-28 Blastp of sequenced clone
CG14570 2003-01-01 Sim4 clustering to Release 3
CG14570 2008-04-29 Release 5.5 accounting
CG14570 2008-08-15 Release 5.9 accounting
CG14570 2008-12-18 5.12 accounting

Clone Sequence Records

RE35615.complete Sequence

804 bp (804 high quality bases) assembled on 2002-03-28

GenBank Submission: AY094868

> RE35615.complete
AGTTCATGTCAGCACACCACAATGTCCGGTTATCCAAGTGCTTCTCTGGT
CACCTTTGCGCTTTGTTCCATTCTTTGCCTGAATGGAATTGAAGGCAGTC
ATCTGAGGTTCCCAGGACCCGCGGCGGGAAGGTTTCTGCAAAGACAGGAA
CAAGCCCCATATCCACCAGCAGGCCTGGTCCCCGATCCGCCATTCGACCT
GCCAACGGAGGAGGCGGTTGAATTTCCTCAACCGGAGGATACATATGGCC
CTCCACCTGAAACATACGGACCACCGTCTTTGGTGGAAGCGCCAGCTGAG
GTCTACGGCCCACCGGACCAAATTTATGGACCTCCCGATCAGACCTACGG
ACCTCCAGACCAGCCAGCCAATGATGACAGCTCCAACACATTGCCACAAA
GCGCAGCTATAATTAATTTGGCAAGTCTGCCGCTACCACCCCAGGCTCAG
TATGTTCTGCCGCTTCTGAACCGACTTTCTGCCTTCCGCCCGCAGCGTCC
GGTTCTGCGGACTCCGCAGCGACGGCCGGCTAAGCTTACGGTTCGTCGTC
GGCCAGATGCGGTCAAGATTGTGAATGCTATTAGGCCTACTCCAGTGTTC
CCATCGACTCCGCAGGCTTTGCCCTTCGTGGATCGCCACATTCCTTTTCG
CCCACGGCCATCTCGCCTGATAGTCAATGCGCCTTTCAGACGCCCATCCA
GGCAATAGACTACTTCTTTCAGCACTCCAAGCAATGTCATGAATACACTG
TAAATAAAGTTTGTTGTCTATGTCTAAAAAATAAAAAAAGAAAAAAAAAA
AAAA

RE35615.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:18:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG14570-RA 780 CG14570-RA 1..777 1..777 3885 100 Plus
Rpb8.a 1007 Rpb8.a 789..1007 777..559 1095 100 Minus
Rpb8-RA 1019 Rpb8-RA 801..1019 777..559 1095 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:57:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 21718608..21719384 777..1 3885 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:51:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:57:01
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21729673..21730449 777..1 3885 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:48:32
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 21722773..21723549 777..1 3885 100 Minus
Blast to na_te.dros performed on 2019-03-16 04:57:01 has no hits.

RE35615.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:57:42 Download gff for RE35615.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 21718608..21719384 1..777 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:12:07 Download gff for RE35615.complete
Subject Subject Range Query Range Percent Splice Strand
CG14570-RA 1..687 22..708 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:23:30 Download gff for RE35615.complete
Subject Subject Range Query Range Percent Splice Strand
CG14570-RA 1..687 22..708 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:46:33 Download gff for RE35615.complete
Subject Subject Range Query Range Percent Splice Strand
CG14570-RA 1..687 22..708 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:59:49 Download gff for RE35615.complete
Subject Subject Range Query Range Percent Splice Strand
CG14570-RA 1..687 22..708 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:55:13 Download gff for RE35615.complete
Subject Subject Range Query Range Percent Splice Strand
CG14570-RA 1..687 22..708 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:50:24 Download gff for RE35615.complete
Subject Subject Range Query Range Percent Splice Strand
CG14570-RA 1..780 1..780 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:23:30 Download gff for RE35615.complete
Subject Subject Range Query Range Percent Splice Strand
CG14570-RA 1..775 1..775 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:46:33 Download gff for RE35615.complete
Subject Subject Range Query Range Percent Splice Strand
CG14570-RA 6..780 1..775 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:59:49 Download gff for RE35615.complete
Subject Subject Range Query Range Percent Splice Strand
CG14570-RA 1..780 1..780 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:55:13 Download gff for RE35615.complete
Subject Subject Range Query Range Percent Splice Strand
CG14570-RA 6..780 1..775 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:57:42 Download gff for RE35615.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21729673..21730449 1..777 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:57:42 Download gff for RE35615.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21729673..21730449 1..777 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:57:42 Download gff for RE35615.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21729673..21730449 1..777 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:46:33 Download gff for RE35615.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21722773..21723549 1..777 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:32:44 Download gff for RE35615.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21722773..21723549 1..777 100   Minus

RE35615.hyp Sequence

Translation from 0 to 707

> RE35615.hyp
SSCQHTTMSGYPSASLVTFALCSILCLNGIEGSHLRFPGPAAGRFLQRQE
QAPYPPAGLVPDPPFDLPTEEAVEFPQPEDTYGPPPETYGPPSLVEAPAE
VYGPPDQIYGPPDQTYGPPDQPANDDSSNTLPQSAAIINLASLPLPPQAQ
YVLPLLNRLSAFRPQRPVLRTPQRRPAKLTVRRRPDAVKIVNAIRPTPVF
PSTPQALPFVDRHIPFRPRPSRLIVNAPFRRPSRQ*

RE35615.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:15:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG14570-PA 228 CG14570-PA 1..228 8..235 1221 100 Plus
CG14568-PA 171 CG14568-PA 6..159 21..173 199 33.7 Plus
CG14569-PA 195 CG14569-PA 4..111 12..134 183 36.1 Plus

RE35615.pep Sequence

Translation from 21 to 707

> RE35615.pep
MSGYPSASLVTFALCSILCLNGIEGSHLRFPGPAAGRFLQRQEQAPYPPA
GLVPDPPFDLPTEEAVEFPQPEDTYGPPPETYGPPSLVEAPAEVYGPPDQ
IYGPPDQTYGPPDQPANDDSSNTLPQSAAIINLASLPLPPQAQYVLPLLN
RLSAFRPQRPVLRTPQRRPAKLTVRRRPDAVKIVNAIRPTPVFPSTPQAL
PFVDRHIPFRPRPSRLIVNAPFRRPSRQ*

RE35615.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:07:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24641-PA 239 GF24641-PA 1..234 1..224 763 70.3 Plus
Dana\GF24639-PA 179 GF24639-PA 7..179 15..184 159 35.4 Plus
Dana\GF24640-PA 186 GF24640-PA 4..92 13..114 152 43.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:07:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13207-PA 228 GG13207-PA 1..228 1..228 1017 88.2 Plus
Dere\GG13205-PA 171 GG13205-PA 62..130 45..127 145 44.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:07:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15096-PA 257 GH15096-PA 20..219 25..224 401 53.6 Plus
Dgri\GH15094-PA 180 GH15094-PA 61..120 45..112 144 57.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:04:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG14570-PA 228 CG14570-PA 1..228 1..228 1221 100 Plus
CG14568-PA 171 CG14568-PA 6..159 14..166 199 33.7 Plus
CG14569-PA 195 CG14569-PA 4..111 5..127 183 36.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:07:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13745-PA 265 GI13745-PA 21..224 24..224 450 54.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:07:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25277-PA 127 GL25277-PA 1..71 1..68 178 57.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:07:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13089-PA 225 GA13089-PA 1..225 1..228 739 68.7 Plus
Dpse\GA13088-PA 196 GA13088-PA 4..95 5..112 144 39.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:07:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22116-PA 228 GM22116-PA 1..228 1..228 1057 92.1 Plus
Dsec\GM22114-PA 171 GM22114-PA 62..159 45..166 142 39.3 Plus
Dsec\GM22115-PA 195 GM22115-PA 4..94 5..113 140 37.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:07:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12093-PA 228 GD12093-PA 1..228 1..228 1067 93.4 Plus
Dsim\GD12091-PA 171 GD12091-PA 62..159 45..166 149 40.2 Plus
Dsim\GD12092-PA 195 GD12092-PA 4..94 5..113 140 37.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:07:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14091-PA 261 GJ14091-PA 22..220 25..224 459 57.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:07:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17127-PA 230 GK17127-PA 1..226 1..224 458 52 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:07:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22987-PA 220 GE22987-PA 1..220 1..228 937 83.3 Plus
Dyak\GE22985-PA 171 GE22985-PA 6..114 14..117 156 37.2 Plus
Dyak\GE22299-PA 171 GE22299-PA 6..114 14..117 156 37.2 Plus