BDGP Sequence Production Resources |
Search the DGRC for RE35766
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 357 |
Well: | 66 |
Vector: | pFlc-1 |
Associated Gene/Transcript | mRpL35-RA |
Protein status: | RE35766.pep: gold |
Sequenced Size: | 756 |
Gene | Date | Evidence |
---|---|---|
CG13410 | 2002-01-01 | Sim4 clustering to Release 2 |
CG13410 | 2002-05-18 | Blastp of sequenced clone |
CG13410 | 2003-01-01 | Sim4 clustering to Release 3 |
mRpL35 | 2008-04-29 | Release 5.5 accounting |
mRpL35 | 2008-08-15 | Release 5.9 accounting |
mRpL35 | 2008-12-18 | 5.12 accounting |
756 bp (756 high quality bases) assembled on 2002-05-18
GenBank Submission: AY119133
> RE35766.complete ATGAGAAGAAGAGCACCTGCGTTTTGTATGGAATTATAGGTTTATCTTTG TCGTTTTAAGTGAAATGCTAAGAACTTTTGTGACAAGCGCGCTGCGAAGC GTTTGCCGCCAGTCGCCGGCTGCATCTTCGTTGGTTCCTCTGGTCCAGCG GACACAACGTGCCACTTTGATGACTCTATCCCGTCCGTGCCTGTTGCCCA CGCCATCACTGGCATCTCCTGCTCATCACCAGCTCCTGCAGCTGCCGGGT GTGCTAGCAGCCACAGGAACACCATCAAACACACGCAACGTGACCAAATT CTCGCTGGTGAAGGGTAAACGAAAGACCGTCAAGGCGGTACTGAAACGTT TTAAGCGCCTGGACTGGGGCGCCTGGATACGCACCCATTCCGGTCGCCAA AAGAAGCTCTTCAAGAAATCCGCAGCTTTACGACGCCGCCTCAAGCAGCA CGTCTTCACCAATGCCACGCAGAGCTGGCTGCTGGACAAGATGGTCACCA GCTATTGGCGGCGCCCAAAGCATTTCATCAACGATCCCTATAAGCCCTAT CACAGCCGCAACGAGTACTACGCCACACAGTCAAAGACCTTTAAGGTGTG ACCTGGCTAATCAAAGATACTACATACTTGAATTAAACAAAACCAAAATA TCTGATTATAGTTTATCTATTGAAAACTACAAAATCATCTATTAAATGCC ATTGTTTCACTAATAACACAAACTTTACAAACACAAAAAAAGAAAAAAAA AAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL35-RA | 1164 | mRpL35-RA | 387..1119 | 4..736 | 3665 | 100 | Plus |
nc_18278.a | 464 | nc_18278.a | 1..232 | 616..385 | 1160 | 100 | Minus |
nc_18278.a | 464 | nc_18278.a | 232..448 | 305..89 | 1085 | 100 | Minus |
CG6028-RA | 1353 | CG6028-RA | 1159..1353 | 736..542 | 975 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 17847312..17847400 | 1..89 | 98 | -> | Plus |
chr3R | 17847465..17848115 | 90..742 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL35-RA | 1..537 | 65..601 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL35-RA | 1..537 | 65..601 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL35-RA | 1..537 | 65..601 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL35-RA | 1..537 | 65..601 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL35-RA | 1..537 | 65..601 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL35-RA | 1..740 | 1..740 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL35-RA | 1..734 | 1..734 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL35-RA | 18..751 | 1..734 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL35-RA | 1..740 | 1..740 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL35-RA | 18..751 | 1..734 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 22023544..22023632 | 1..89 | 98 | -> | Plus |
3R | 22023697..22024347 | 90..742 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 22023544..22023632 | 1..89 | 98 | -> | Plus |
3R | 22023697..22024347 | 90..742 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 22023544..22023632 | 1..89 | 98 | -> | Plus |
3R | 22023697..22024347 | 90..742 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 17849266..17849354 | 1..89 | 98 | -> | Plus |
arm_3R | 17849419..17850069 | 90..742 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 21764528..21765178 | 90..742 | 99 | Plus | |
3R | 21764375..21764463 | 1..89 | 98 | -> | Plus |
Translation from 64 to 600
> RE35766.pep MLRTFVTSALRSVCRQSPAASSLVPLVQRTQRATLMTLSRPCLLPTPSLA SPAHHQLLQLPGVLAATGTPSNTRNVTKFSLVKGKRKTVKAVLKRFKRLD WGAWIRTHSGRQKKLFKKSAALRRRLKQHVFTNATQSWLLDKMVTSYWRR PKHFINDPYKPYHSRNEYYATQSKTFKV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF18062-PA | 176 | GF18062-PA | 1..176 | 1..178 | 704 | 75.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11099-PA | 178 | GG11099-PA | 1..178 | 1..178 | 889 | 94.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20964-PA | 177 | GH20964-PA | 1..177 | 1..178 | 606 | 69.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL35-PA | 178 | CG13410-PA | 1..178 | 1..178 | 927 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10454-PA | 172 | GI10454-PA | 1..172 | 1..178 | 556 | 65.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL23809-PA | 175 | GL23809-PA | 1..175 | 1..178 | 622 | 72.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12267-PA | 175 | GA12267-PA | 1..175 | 1..178 | 627 | 73.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM26393-PA | 178 | GM26393-PA | 1..178 | 1..178 | 925 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD20915-PA | 178 | GD20915-PA | 1..178 | 1..178 | 921 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23141-PA | 174 | GJ23141-PA | 1..174 | 1..178 | 578 | 66.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14238-PA | 176 | GK14238-PA | 1..176 | 1..178 | 546 | 65.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE10261-PA | 180 | GE10261-PA | 1..180 | 1..178 | 887 | 95 | Plus |
Translation from 64 to 600
> RE35766.hyp MLRTFVTSALRSVCRQSPAASSLVPLVQRTQRATLMTLSRPCLLPTPSLA SPAHHQLLQLPGVLAATGTPSNTRNVTKFSLVKGKRKTVKAVLKRFKRLD WGAWIRTHSGRQKKLFKKSAALRRRLKQHVFTNATQSWLLDKMVTSYWRR PKHFINDPYKPYHSRNEYYATQSKTFKV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL35-PA | 178 | CG13410-PA | 1..178 | 1..178 | 927 | 100 | Plus |