Clone RE35766 Report

Search the DGRC for RE35766

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:357
Well:66
Vector:pFlc-1
Associated Gene/TranscriptmRpL35-RA
Protein status:RE35766.pep: gold
Sequenced Size:756

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13410 2002-01-01 Sim4 clustering to Release 2
CG13410 2002-05-18 Blastp of sequenced clone
CG13410 2003-01-01 Sim4 clustering to Release 3
mRpL35 2008-04-29 Release 5.5 accounting
mRpL35 2008-08-15 Release 5.9 accounting
mRpL35 2008-12-18 5.12 accounting

Clone Sequence Records

RE35766.complete Sequence

756 bp (756 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119133

> RE35766.complete
ATGAGAAGAAGAGCACCTGCGTTTTGTATGGAATTATAGGTTTATCTTTG
TCGTTTTAAGTGAAATGCTAAGAACTTTTGTGACAAGCGCGCTGCGAAGC
GTTTGCCGCCAGTCGCCGGCTGCATCTTCGTTGGTTCCTCTGGTCCAGCG
GACACAACGTGCCACTTTGATGACTCTATCCCGTCCGTGCCTGTTGCCCA
CGCCATCACTGGCATCTCCTGCTCATCACCAGCTCCTGCAGCTGCCGGGT
GTGCTAGCAGCCACAGGAACACCATCAAACACACGCAACGTGACCAAATT
CTCGCTGGTGAAGGGTAAACGAAAGACCGTCAAGGCGGTACTGAAACGTT
TTAAGCGCCTGGACTGGGGCGCCTGGATACGCACCCATTCCGGTCGCCAA
AAGAAGCTCTTCAAGAAATCCGCAGCTTTACGACGCCGCCTCAAGCAGCA
CGTCTTCACCAATGCCACGCAGAGCTGGCTGCTGGACAAGATGGTCACCA
GCTATTGGCGGCGCCCAAAGCATTTCATCAACGATCCCTATAAGCCCTAT
CACAGCCGCAACGAGTACTACGCCACACAGTCAAAGACCTTTAAGGTGTG
ACCTGGCTAATCAAAGATACTACATACTTGAATTAAACAAAACCAAAATA
TCTGATTATAGTTTATCTATTGAAAACTACAAAATCATCTATTAAATGCC
ATTGTTTCACTAATAACACAAACTTTACAAACACAAAAAAAGAAAAAAAA
AAAAAA

RE35766.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:46:06
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL35-RA 1164 mRpL35-RA 387..1119 4..736 3665 100 Plus
nc_18278.a 464 nc_18278.a 1..232 616..385 1160 100 Minus
nc_18278.a 464 nc_18278.a 232..448 305..89 1085 100 Minus
CG6028-RA 1353 CG6028-RA 1159..1353 736..542 975 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:46:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 17847464..17848111 89..736 3180 99.4 Plus
chr3R 27901430 chr3R 17847315..17847400 4..89 430 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:52:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:46:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22023696..22024343 89..736 3240 100 Plus
3R 32079331 3R 22023547..22023632 4..89 430 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:08:40
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 21764527..21765174 89..736 3240 100 Plus
3R 31820162 3R 21764378..21764463 4..89 430 100 Plus
Blast to na_te.dros performed on 2019-03-15 19:46:50 has no hits.

RE35766.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:47:29 Download gff for RE35766.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 17847312..17847400 1..89 98 -> Plus
chr3R 17847465..17848115 90..742 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:12:16 Download gff for RE35766.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL35-RA 1..537 65..601 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:06:57 Download gff for RE35766.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL35-RA 1..537 65..601 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:57:47 Download gff for RE35766.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL35-RA 1..537 65..601 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:18:03 Download gff for RE35766.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL35-RA 1..537 65..601 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:23:52 Download gff for RE35766.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL35-RA 1..537 65..601 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:45:45 Download gff for RE35766.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL35-RA 1..740 1..740 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:06:57 Download gff for RE35766.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL35-RA 1..734 1..734 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:57:47 Download gff for RE35766.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL35-RA 18..751 1..734 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:18:04 Download gff for RE35766.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL35-RA 1..740 1..740 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:23:52 Download gff for RE35766.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL35-RA 18..751 1..734 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:47:29 Download gff for RE35766.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22023544..22023632 1..89 98 -> Plus
3R 22023697..22024347 90..742 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:47:29 Download gff for RE35766.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22023544..22023632 1..89 98 -> Plus
3R 22023697..22024347 90..742 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:47:29 Download gff for RE35766.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22023544..22023632 1..89 98 -> Plus
3R 22023697..22024347 90..742 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:57:47 Download gff for RE35766.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17849266..17849354 1..89 98 -> Plus
arm_3R 17849419..17850069 90..742 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:07:58 Download gff for RE35766.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21764528..21765178 90..742 99   Plus
3R 21764375..21764463 1..89 98 -> Plus

RE35766.pep Sequence

Translation from 64 to 600

> RE35766.pep
MLRTFVTSALRSVCRQSPAASSLVPLVQRTQRATLMTLSRPCLLPTPSLA
SPAHHQLLQLPGVLAATGTPSNTRNVTKFSLVKGKRKTVKAVLKRFKRLD
WGAWIRTHSGRQKKLFKKSAALRRRLKQHVFTNATQSWLLDKMVTSYWRR
PKHFINDPYKPYHSRNEYYATQSKTFKV*

RE35766.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:12:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18062-PA 176 GF18062-PA 1..176 1..178 704 75.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:12:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11099-PA 178 GG11099-PA 1..178 1..178 889 94.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:12:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20964-PA 177 GH20964-PA 1..177 1..178 606 69.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:14
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL35-PA 178 CG13410-PA 1..178 1..178 927 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:12:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10454-PA 172 GI10454-PA 1..172 1..178 556 65.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:12:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23809-PA 175 GL23809-PA 1..175 1..178 622 72.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:12:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12267-PA 175 GA12267-PA 1..175 1..178 627 73.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:12:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26393-PA 178 GM26393-PA 1..178 1..178 925 98.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:12:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20915-PA 178 GD20915-PA 1..178 1..178 921 97.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:12:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23141-PA 174 GJ23141-PA 1..174 1..178 578 66.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:12:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14238-PA 176 GK14238-PA 1..176 1..178 546 65.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:12:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10261-PA 180 GE10261-PA 1..180 1..178 887 95 Plus

RE35766.hyp Sequence

Translation from 64 to 600

> RE35766.hyp
MLRTFVTSALRSVCRQSPAASSLVPLVQRTQRATLMTLSRPCLLPTPSLA
SPAHHQLLQLPGVLAATGTPSNTRNVTKFSLVKGKRKTVKAVLKRFKRLD
WGAWIRTHSGRQKKLFKKSAALRRRLKQHVFTNATQSWLLDKMVTSYWRR
PKHFINDPYKPYHSRNEYYATQSKTFKV*

RE35766.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:19:39
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL35-PA 178 CG13410-PA 1..178 1..178 927 100 Plus