Clone RE35907 Report

Search the DGRC for RE35907

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:359
Well:7
Vector:pFlc-1
Associated Gene/TranscriptCG13220-RA
Protein status:RE35907.pep: gold
Preliminary Size:659
Sequenced Size:697

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13220 2002-01-01 Sim4 clustering to Release 2
CG13220 2003-01-01 Sim4 clustering to Release 3
CG13220 2003-08-11 Blastp of sequenced clone
CG13220 2008-04-29 Release 5.5 accounting
CG13220 2008-08-15 Release 5.9 accounting
CG13220 2008-12-18 5.12 accounting

Clone Sequence Records

RE35907.complete Sequence

697 bp (697 high quality bases) assembled on 2003-08-11

GenBank Submission: BT011056

> RE35907.complete
CGTATTCTTTACATAACAAGAAGAAGAAGACTCGTCGACCTCACCGGGAT
CCAAAAACTTAATTGCATTTTCACCGATAATAATGGCCGGGACACAGTCA
AAAGACGCCTGCAGCATATGCGACAAAGTGGGCCTCAAGCCCTTCACCCG
GGATAATGTGTTCAACTACTACATACCGCTGCACGGCCTGGTGAGCTACG
GAGCCCTTGCGGTGAATGTTATGAACCCCCAGATCGTGCCCAAAATCCTG
CCCAAGAAGGACCTGACGAACGTGTTCCTCATCTCCGCGGTGGTGGGCAG
TGCCTTCTACATTTACGGCAGGCCCCACCTGAAGGACGTGAAGAACAACA
AGCGAGGTGCGTACGCCCTGCTGGGCGCCACCCTATTCTCCATGGGATCC
GTTCTGGCCTGGGCGCTCATCAAGTCCGCCCTGCCACAGGACAATGCACT
GCTGGCGACCCTGGCGGGCTTGGGAACTGGCGCCGCCATCGTGAAGGTCG
GCACTGATTACATTCAGGACGTGGATAAGCTGCAGAAGAACTAGATGATC
TGATCGATACGATATAGGACTGAGGTATTCGAACCCAAAAGTGGGTTCGT
ACTGTAATTGCTGTCTTGGCCGTACATAGCTCGTAATGCAATATTATCTC
CCGCATATTTGAATAAAATTATACTATAAACCCAAAAAAAAAAAAAA

RE35907.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:31:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG13220-RA 685 CG13220-RA 3..683 3..683 3405 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:43:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7171870..7172550 3..683 3405 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:52:12 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:43:42
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11284418..11285098 3..683 3405 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:59:53
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11285617..11286297 3..683 3405 100 Plus
Blast to na_te.dros performed on 2019-03-16 19:43:42 has no hits.

RE35907.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:44:23 Download gff for RE35907.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7171868..7172550 1..683 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:12:22 Download gff for RE35907.complete
Subject Subject Range Query Range Percent Splice Strand
CG13220-RA 1..462 83..544 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:51:59 Download gff for RE35907.complete
Subject Subject Range Query Range Percent Splice Strand
CG13220-RA 1..462 83..544 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:46:47 Download gff for RE35907.complete
Subject Subject Range Query Range Percent Splice Strand
CG13220-RA 1..462 83..544 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:17:58 Download gff for RE35907.complete
Subject Subject Range Query Range Percent Splice Strand
CG13220-RA 1..462 83..544 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:41:40 Download gff for RE35907.complete
Subject Subject Range Query Range Percent Splice Strand
CG13220-RA 1..462 83..544 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:15:35 Download gff for RE35907.complete
Subject Subject Range Query Range Percent Splice Strand
CG13220-RA 1..683 1..683 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:51:59 Download gff for RE35907.complete
Subject Subject Range Query Range Percent Splice Strand
CG13220-RA 1..683 1..683 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:46:47 Download gff for RE35907.complete
Subject Subject Range Query Range Percent Splice Strand
CG13220-RA 3..685 1..683 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:17:59 Download gff for RE35907.complete
Subject Subject Range Query Range Percent Splice Strand
CG13220-RA 1..683 1..683 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:41:40 Download gff for RE35907.complete
Subject Subject Range Query Range Percent Splice Strand
CG13220-RA 3..685 1..683 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:44:23 Download gff for RE35907.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11284416..11285098 1..683 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:44:23 Download gff for RE35907.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11284416..11285098 1..683 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:44:23 Download gff for RE35907.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11284416..11285098 1..683 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:46:47 Download gff for RE35907.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7171921..7172603 1..683 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:52:06 Download gff for RE35907.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11285615..11286297 1..683 99   Plus

RE35907.hyp Sequence

Translation from 82 to 543

> RE35907.hyp
MAGTQSKDACSICDKVGLKPFTRDNVFNYYIPLHGLVSYGALAVNVMNPQ
IVPKILPKKDLTNVFLISAVVGSAFYIYGRPHLKDVKNNKRGAYALLGAT
LFSMGSVLAWALIKSALPQDNALLATLAGLGTGAAIVKVGTDYIQDVDKL
QKN*

RE35907.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:13:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG13220-PB 153 CG13220-PB 1..153 1..153 782 100 Plus
CG13220-PA 153 CG13220-PA 1..153 1..153 782 100 Plus

RE35907.pep Sequence

Translation from 82 to 543

> RE35907.pep
MAGTQSKDACSICDKVGLKPFTRDNVFNYYIPLHGLVSYGALAVNVMNPQ
IVPKILPKKDLTNVFLISAVVGSAFYIYGRPHLKDVKNNKRGAYALLGAT
LFSMGSVLAWALIKSALPQDNALLATLAGLGTGAAIVKVGTDYIQDVDKL
QKN*

RE35907.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:06:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12541-PA 153 GF12541-PA 1..153 1..153 736 90.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:06:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20186-PA 153 GG20186-PA 1..153 1..153 790 99.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:06:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19950-PA 152 GH19950-PA 1..151 1..151 696 85.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:10:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG13220-PB 153 CG13220-PB 1..153 1..153 782 100 Plus
CG13220-PA 153 CG13220-PA 1..153 1..153 782 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:06:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19907-PA 153 GI19907-PA 1..153 1..153 724 85.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:06:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17724-PA 153 GL17724-PA 1..153 1..153 652 77.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:06:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12132-PA 152 GA12132-PA 1..152 1..153 634 76.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:06:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21274-PA 153 GM21274-PA 1..153 1..153 793 100 Plus
Dsec\GM26716-PA 141 GM26716-PA 1..132 1..132 680 99.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:06:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10786-PA 153 GD10786-PA 1..153 1..153 793 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:06:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15075-PA 152 GJ15075-PA 1..151 1..151 723 88.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:06:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21684-PA 150 GK21684-PA 7..148 10..151 674 86.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:06:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12874-PA 153 GE12874-PA 1..153 1..153 788 99.3 Plus