BDGP Sequence Production Resources |
Search the DGRC for RE35907
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 359 |
Well: | 7 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG13220-RA |
Protein status: | RE35907.pep: gold |
Preliminary Size: | 659 |
Sequenced Size: | 697 |
Gene | Date | Evidence |
---|---|---|
CG13220 | 2002-01-01 | Sim4 clustering to Release 2 |
CG13220 | 2003-01-01 | Sim4 clustering to Release 3 |
CG13220 | 2003-08-11 | Blastp of sequenced clone |
CG13220 | 2008-04-29 | Release 5.5 accounting |
CG13220 | 2008-08-15 | Release 5.9 accounting |
CG13220 | 2008-12-18 | 5.12 accounting |
697 bp (697 high quality bases) assembled on 2003-08-11
GenBank Submission: BT011056
> RE35907.complete CGTATTCTTTACATAACAAGAAGAAGAAGACTCGTCGACCTCACCGGGAT CCAAAAACTTAATTGCATTTTCACCGATAATAATGGCCGGGACACAGTCA AAAGACGCCTGCAGCATATGCGACAAAGTGGGCCTCAAGCCCTTCACCCG GGATAATGTGTTCAACTACTACATACCGCTGCACGGCCTGGTGAGCTACG GAGCCCTTGCGGTGAATGTTATGAACCCCCAGATCGTGCCCAAAATCCTG CCCAAGAAGGACCTGACGAACGTGTTCCTCATCTCCGCGGTGGTGGGCAG TGCCTTCTACATTTACGGCAGGCCCCACCTGAAGGACGTGAAGAACAACA AGCGAGGTGCGTACGCCCTGCTGGGCGCCACCCTATTCTCCATGGGATCC GTTCTGGCCTGGGCGCTCATCAAGTCCGCCCTGCCACAGGACAATGCACT GCTGGCGACCCTGGCGGGCTTGGGAACTGGCGCCGCCATCGTGAAGGTCG GCACTGATTACATTCAGGACGTGGATAAGCTGCAGAAGAACTAGATGATC TGATCGATACGATATAGGACTGAGGTATTCGAACCCAAAAGTGGGTTCGT ACTGTAATTGCTGTCTTGGCCGTACATAGCTCGTAATGCAATATTATCTC CCGCATATTTGAATAAAATTATACTATAAACCCAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13220-RA | 685 | CG13220-RA | 3..683 | 3..683 | 3405 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 7171870..7172550 | 3..683 | 3405 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 11284418..11285098 | 3..683 | 3405 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 11285617..11286297 | 3..683 | 3405 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 7171868..7172550 | 1..683 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13220-RA | 1..462 | 83..544 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13220-RA | 1..462 | 83..544 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13220-RA | 1..462 | 83..544 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13220-RA | 1..462 | 83..544 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13220-RA | 1..462 | 83..544 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13220-RA | 1..683 | 1..683 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13220-RA | 1..683 | 1..683 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13220-RA | 3..685 | 1..683 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13220-RA | 1..683 | 1..683 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13220-RA | 3..685 | 1..683 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 11284416..11285098 | 1..683 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 11284416..11285098 | 1..683 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 11284416..11285098 | 1..683 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 7171921..7172603 | 1..683 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 11285615..11286297 | 1..683 | 99 | Plus |
Translation from 82 to 543
> RE35907.hyp MAGTQSKDACSICDKVGLKPFTRDNVFNYYIPLHGLVSYGALAVNVMNPQ IVPKILPKKDLTNVFLISAVVGSAFYIYGRPHLKDVKNNKRGAYALLGAT LFSMGSVLAWALIKSALPQDNALLATLAGLGTGAAIVKVGTDYIQDVDKL QKN*
Translation from 82 to 543
> RE35907.pep MAGTQSKDACSICDKVGLKPFTRDNVFNYYIPLHGLVSYGALAVNVMNPQ IVPKILPKKDLTNVFLISAVVGSAFYIYGRPHLKDVKNNKRGAYALLGAT LFSMGSVLAWALIKSALPQDNALLATLAGLGTGAAIVKVGTDYIQDVDKL QKN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12541-PA | 153 | GF12541-PA | 1..153 | 1..153 | 736 | 90.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20186-PA | 153 | GG20186-PA | 1..153 | 1..153 | 790 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH19950-PA | 152 | GH19950-PA | 1..151 | 1..151 | 696 | 85.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13220-PB | 153 | CG13220-PB | 1..153 | 1..153 | 782 | 100 | Plus |
CG13220-PA | 153 | CG13220-PA | 1..153 | 1..153 | 782 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19907-PA | 153 | GI19907-PA | 1..153 | 1..153 | 724 | 85.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17724-PA | 153 | GL17724-PA | 1..153 | 1..153 | 652 | 77.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12132-PA | 152 | GA12132-PA | 1..152 | 1..153 | 634 | 76.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21274-PA | 153 | GM21274-PA | 1..153 | 1..153 | 793 | 100 | Plus |
Dsec\GM26716-PA | 141 | GM26716-PA | 1..132 | 1..132 | 680 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD10786-PA | 153 | GD10786-PA | 1..153 | 1..153 | 793 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ15075-PA | 152 | GJ15075-PA | 1..151 | 1..151 | 723 | 88.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK21684-PA | 150 | GK21684-PA | 7..148 | 10..151 | 674 | 86.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12874-PA | 153 | GE12874-PA | 1..153 | 1..153 | 788 | 99.3 | Plus |