Clone RE36241 Report

Search the DGRC for RE36241

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:362
Well:41
Vector:pFlc-1
Associated Gene/TranscriptCG11454-RA
Protein status:RE36241.pep:
Sequenced Size:865

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11454 2003-01-01 Sim4 clustering to Release 3
CG11454 2008-04-29 Release 5.5 accounting
CG11454 2008-08-15 Release 5.9 accounting
CG11454 2008-12-18 5.12 accounting

Clone Sequence Records

RE36241.complete Sequence

865 bp (865 high quality bases) assembled on 2004-08-14

GenBank Submission: BT021281

> RE36241.complete
AAAGGGACTTGCAGTTACTAATGCAGCAAATGTATAGTGGTGCGTCGGTC
ATGACGATTTCGGAAACGAACATAGATGGTTACAGATACGGTATTCCATC
TGGCCAGCACCAAGAGCAGCCAATTTACCCTTTCCTGCCCAATGAAAACG
GTGACCAGTTGGTTGGGCAACTGGAGGACGACGACGATGAGGAGGAGGAC
GAGGAGCAACGGACTCTGTTCTGCGGGAATCTCGACGAGCGCGTGACGGA
GGAGATCCTTTACGAGGTGTTCCTGCAAGCTGGCCCCATCGAAGGAGTGC
GGATACCGACCGATAACAATGGGCGTCCCCGGAATTTCGGGTTTGTCACA
TACCAACGCCTGTGTGCGGTGCCTTTTGCCCTAGACTTGTACCAGGGCCT
TGAACTGTTCCAAAAGAAAGTCACCATCAAGCAGCAGGGCGGCAAGCAGC
TACCTGCCTACAACCAAAGTCGTCTGCGCAATCAGTTCATGATGGAGGCT
CTACCGCAGCCATCGCCACTGCGTCACGCCCGACACAGTTTGCATAACGG
CAAGCCGTACGATCGCAATCCTTTTGGACACAACGCCGATCAACGGCGCC
GGAGCGACAGCTCCGTAATGGAACGCAACCGGCTAAAACCACAGCAACAC
CACCAGCACATGCAGGGAGGCAGCAGAAGATCGGACCAACGCTCCAACAA
CAAACGCAGATTGCTTTAAGATTTCACCACATTTTCGTCTTTATGTATAC
CCTAGTCCTTCAGTTACTCAAAACCAAAATCAAAAGTTACCGTCTTTAAT
CGTTTAATGAGCTGGATATCTGCAGAAAATTATGTATCAAATGAAGCAGT
TTAAAAAAAAAAAAA

RE36241.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:58:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG11454-RA 919 CG11454-RA 68..919 1..852 4245 99.8 Plus
CG11454.a 812 CG11454.a 74..812 114..852 3695 100 Plus
CG11454.a 812 CG11454.a 36..74 1..39 180 97.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:54:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 143413..144264 1..852 4245 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:52:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:54:43
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 143376..144228 1..853 4250 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:46:46
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 143376..144228 1..853 4250 99.8 Plus
Blast to na_te.dros performed on 2019-03-16 22:54:44 has no hits.

RE36241.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:55:39 Download gff for RE36241.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 143413..144264 1..852 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:12:31 Download gff for RE36241.complete
Subject Subject Range Query Range Percent Splice Strand
CG11454-RA 1..717 3..719 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:32:11 Download gff for RE36241.complete
Subject Subject Range Query Range Percent Splice Strand
CG11454-RA 1..717 3..719 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:17:42 Download gff for RE36241.complete
Subject Subject Range Query Range Percent Splice Strand
CG11454-RA 1..717 3..719 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:16:00 Download gff for RE36241.complete
Subject Subject Range Query Range Percent Splice Strand
CG11454-RA 1..717 3..719 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:44:58 Download gff for RE36241.complete
Subject Subject Range Query Range Percent Splice Strand
CG11454-RA 1..717 3..719 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:37:15 Download gff for RE36241.complete
Subject Subject Range Query Range Percent Splice Strand
CG11454-RA 1..852 1..852 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:32:10 Download gff for RE36241.complete
Subject Subject Range Query Range Percent Splice Strand
CG11454-RA 68..919 1..852 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:17:42 Download gff for RE36241.complete
Subject Subject Range Query Range Percent Splice Strand
CG11454-RA 54..905 1..852 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:16:00 Download gff for RE36241.complete
Subject Subject Range Query Range Percent Splice Strand
CG11454-RA 1..852 1..852 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:44:58 Download gff for RE36241.complete
Subject Subject Range Query Range Percent Splice Strand
CG11454-RA 54..905 1..852 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:55:39 Download gff for RE36241.complete
Subject Subject Range Query Range Percent Splice Strand
2L 143376..144227 1..852 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:55:39 Download gff for RE36241.complete
Subject Subject Range Query Range Percent Splice Strand
2L 143376..144227 1..852 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:55:39 Download gff for RE36241.complete
Subject Subject Range Query Range Percent Splice Strand
2L 143376..144227 1..852 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:17:42 Download gff for RE36241.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 143376..144227 1..852 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:52:58 Download gff for RE36241.complete
Subject Subject Range Query Range Percent Splice Strand
2L 143376..144227 1..852 99   Plus

RE36241.pep Sequence

Translation from 2 to 718

> RE36241.pep
RDLQLLMQQMYSGASVMTISETNIDGYRYGIPSGQHQEQPIYPFLPNENG
DQLVGQLEDDDDEEEDEEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVR
IPTDNNGRPRNFGFVTYQRLCAVPFALDLYQGLELFQKKVTIKQQGGKQL
PAYNQSRLRNQFMMEALPQPSPLRHARHSLHNGKPYDRNPFGHNADQRRR
SDSSVMERNRLKPQQHHQHMQGGSRRSDQRSNNKRRLL*

RE36241.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:07:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14865-PA 241 GF14865-PA 2..241 2..237 618 59.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:07:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24699-PA 238 GG24699-PA 2..238 2..238 1009 85.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:07:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10062-PA 251 GH10062-PA 76..251 70..238 467 60.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG11454-PA 238 CG11454-PA 2..238 2..238 1261 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:07:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16471-PA 252 GI16471-PA 40..252 26..238 459 51.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:07:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13956-PA 238 GL13956-PA 2..238 2..238 579 58.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:07:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11013-PA 238 GA11013-PA 2..238 2..238 583 59.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:07:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16717-PA 237 GM16717-PA 2..237 2..238 1083 91.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:07:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23003-PA 238 GD23003-PA 2..238 2..238 1081 92 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:07:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16219-PA 249 GJ16219-PA 72..249 68..238 463 58 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:07:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24608-PA 255 GK24608-PA 79..255 70..237 467 59.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:07:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16604-PA 240 GE16604-PA 2..240 2..238 967 83.7 Plus

RE36241.hyp Sequence

Translation from 2 to 718

> RE36241.hyp
MDLQLLMQQMYSGASVMTISETNIDGYRYGIPSGQHQEQPIYPFLPNENG
DQLVGQLEDDDDEEEDEEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVR
IPTDNNGRPRNFGFVTYQRLCAVPFALDLYQGLELFQKKVTIKQQGGKQL
PAYNQSRLRNQFMMEALPQPSPLRHARHSLHNGKPYDRNPFGHNADQRRR
SDSSVMERNRLKPQQHHQHMQGGSRRSDQRSNNKRRLL*

RE36241.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:00:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG11454-PA 238 CG11454-PA 1..238 1..238 1266 100 Plus