Clone RE36486 Report

Search the DGRC for RE36486

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:364
Well:86
Vector:pFlc-1
Associated Gene/TranscriptATPsyn-b-RA
Protein status:RE36486.pep: gold
Sequenced Size:956

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8189 2004-01-14 Blastp of sequenced clone
ATPsyn-b 2008-04-29 Release 5.5 accounting
ATPsyn-b 2008-08-15 Release 5.9 accounting
ATPsyn-b 2008-12-18 5.12 accounting

Clone Sequence Records

RE36486.complete Sequence

956 bp (956 high quality bases) assembled on 2004-01-14

GenBank Submission: BT011453

> RE36486.complete
GATCTGGCAACGCTCTCTTAACCTGTCACTATTGTGAACTGACAATTTCG
GGTGAATTTAGTAGCATAAATTCGTCGCAACTGCCTGGAAAATGTTCTCG
AGAGCCGCTCTTCTAACAGCCCAGCGCCCCTTGACCGTGGCCGCCACCCG
GTCGGCAGCCGCTGCTGCCGCTCCTGGCGGAGCCATCGAGCGCCGCCAGC
GCCCCGAGCATCCCGGCAAGGTCCGTCTGGGATTCCTGCCCGAGGAGTGG
TTCCAGTTCTTCTACAACAAGACCGGTGTCACCGGACCCTACACCTTCGG
CGTGGGTCTGATCACCTATCTCTGCTCCAAGGAGATCTACGTCATGGAGC
ACGAGTACTACAGCGGTCTGTCGCTCGGTATCATGGCCATCATTGCTGTC
AAGAAGCTCGGCCCGGTCATCGCCAAGTGGGCTGATGGCGAGATCGATAA
AATCGAATCTGAGTGGAAGGAGGGACGCGAGGCTGAGCTGAAGGTCCTCT
CCGACGCCATCGAGGCCGAGAAGAAGGAGCAGTGGCGCGCCGACGGTGCC
CTGCTGCTGATGGAAGCCAAGAAGGAGAACATTGCATTGCAGCTGGAGGC
CGCGTTCCGTGAGCGCGCCATGAATGTGTACTCGGAGGTGAAGCGTCGTC
TCGACTACCAGGTGGAGTGCCGCCACGTCGAGCGTCGCCTTAGCCAGAAG
CACATGGTCAACTGGATCACCACCAATGTGTTGGCCAGCATCTCTCCCCA
GCAGGAGAAGGAGACTCTCAACAAGTGCATCGCCGATCTGAGCGCTCTGG
CACTGCGCGTCAAGTCTGCCTAAACGATTCGAGTTTTAGTTGTTTATTTG
TAAATTAAAACCCATTCGAGACGCTGGAACCATGAATATGCCCGAAAGAT
GATAAATCGATCCAATATATCTTCAAAATGTCCGTGTCTGAAAAAAAAAA
AAAAAA

RE36486.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:08:13
Subject Length Description Subject Range Query Range Score Percent Strand
ATPsyn-b.a 1075 ATPsyn-b.a 124..1067 1..944 4720 100 Plus
ATPsyn-b-RA 994 ATPsyn-b-RA 43..986 1..944 4720 100 Plus
ATPsyn-b-RB 1165 ATPsyn-b-RB 333..1160 117..944 4140 100 Plus
ATPsyn-b-RB 1165 ATPsyn-b-RB 1..119 1..119 595 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:57:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 9722587..9723078 449..940 2460 100 Plus
chr3L 24539361 chr3L 9722163..9722494 117..448 1660 100 Plus
chr3L 24539361 chr3L 9721831..9721949 1..119 595 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:52:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:57:48
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9730733..9731228 449..944 2480 100 Plus
3L 28110227 3L 9730309..9730640 117..448 1660 100 Plus
3L 28110227 3L 9729977..9730095 1..119 595 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:53:26
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 9723833..9724328 449..944 2480 100 Plus
3L 28103327 3L 9723409..9723740 117..448 1660 100 Plus
3L 28103327 3L 9723077..9723195 1..119 595 100 Plus
Blast to na_te.dros performed on 2019-03-16 01:57:48 has no hits.

RE36486.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:58:32 Download gff for RE36486.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 9721831..9721949 1..119 100 -> Plus
chr3L 9722166..9722494 120..448 100 -> Plus
chr3L 9722587..9723078 449..940 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:12:33 Download gff for RE36486.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-b-RA 1..732 92..823 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:41:55 Download gff for RE36486.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-b-RA 1..732 92..823 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:12:33 Download gff for RE36486.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-b-RA 1..732 92..823 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:30:41 Download gff for RE36486.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-b-RA 1..732 92..823 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:53:01 Download gff for RE36486.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-b-RA 1..732 92..823 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:51:22 Download gff for RE36486.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-b-RA 1..940 1..940 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:41:55 Download gff for RE36486.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-b-RA 1..940 1..940 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:12:33 Download gff for RE36486.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-b-RA 1..918 23..940 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:30:42 Download gff for RE36486.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-b-RA 1..940 1..940 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:53:01 Download gff for RE36486.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-b-RA 1..918 23..940 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:58:32 Download gff for RE36486.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9729977..9730095 1..119 100 -> Plus
3L 9730312..9730640 120..448 100 -> Plus
3L 9730733..9731224 449..940 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:58:32 Download gff for RE36486.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9729977..9730095 1..119 100 -> Plus
3L 9730312..9730640 120..448 100 -> Plus
3L 9730733..9731224 449..940 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:58:32 Download gff for RE36486.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9729977..9730095 1..119 100 -> Plus
3L 9730312..9730640 120..448 100 -> Plus
3L 9730733..9731224 449..940 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:12:33 Download gff for RE36486.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9723077..9723195 1..119 100 -> Plus
arm_3L 9723412..9723740 120..448 100 -> Plus
arm_3L 9723833..9724324 449..940 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:03:14 Download gff for RE36486.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9723412..9723740 120..448 100 -> Plus
3L 9723833..9724324 449..940 100   Plus
3L 9723077..9723195 1..119 100 -> Plus

RE36486.pep Sequence

Translation from 91 to 822

> RE36486.pep
MFSRAALLTAQRPLTVAATRSAAAAAAPGGAIERRQRPEHPGKVRLGFLP
EEWFQFFYNKTGVTGPYTFGVGLITYLCSKEIYVMEHEYYSGLSLGIMAI
IAVKKLGPVIAKWADGEIDKIESEWKEGREAELKVLSDAIEAEKKEQWRA
DGALLLMEAKKENIALQLEAAFRERAMNVYSEVKRRLDYQVECRHVERRL
SQKHMVNWITTNVLASISPQQEKETLNKCIADLSALALRVKSA*

RE36486.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:50:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24674-PA 245 GF24674-PA 1..245 1..243 1251 96.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:50:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15409-PA 243 GG15409-PA 1..243 1..243 1275 98.4 Plus
Dere\GG13783-PA 151 GG13783-PA 1..142 1..146 254 42.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:50:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15429-PA 246 GH15429-PA 1..245 1..242 1122 89.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:27:22
Subject Length Description Subject Range Query Range Score Percent Strand
ATPsynB-PA 243 CG8189-PA 1..243 1..243 1237 100 Plus
CG17300-PA 152 CG17300-PA 1..133 1..137 245 43.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:50:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13031-PA 245 GI13031-PA 1..245 1..243 1116 90.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:50:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16292-PA 245 GL16292-PA 1..245 1..243 1163 94.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:50:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20881-PA 245 GA20881-PA 1..245 1..243 1163 95.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:50:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25183-PA 243 GM25183-PA 1..243 1..243 1284 99.6 Plus
Dsec\GM24609-PA 152 GM24609-PA 1..133 1..137 273 44.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:50:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14214-PA 243 GD14214-PA 1..243 1..243 1284 99.6 Plus
Dsim\GD12675-PA 141 GD12675-PA 1..122 16..137 226 41.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:50:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12126-PA 246 GJ12126-PA 1..243 1..241 1125 90.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:50:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10957-PA 243 GK10957-PA 1..243 1..243 1139 93 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:50:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20875-PA 243 GE20875-PA 1..243 1..243 1281 99.2 Plus
Dyak\GE20077-PA 73 GE20077-PA 1..54 85..137 142 57.4 Plus

RE36486.hyp Sequence

Translation from 91 to 822

> RE36486.hyp
MFSRAALLTAQRPLTVAATRSAAAAAAPGGAIERRQRPEHPGKVRLGFLP
EEWFQFFYNKTGVTGPYTFGVGLITYLCSKEIYVMEHEYYSGLSLGIMAI
IAVKKLGPVIAKWADGEIDKIESEWKEGREAELKVLSDAIEAEKKEQWRA
DGALLLMEAKKENIALQLEAAFRERAMNVYSEVKRRLDYQVECRHVERRL
SQKHMVNWITTNVLASISPQQEKETLNKCIADLSALALRVKSA*

RE36486.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:00:01
Subject Length Description Subject Range Query Range Score Percent Strand
ATPsyn-b-PA 243 CG8189-PA 1..243 1..243 1237 100 Plus
CG17300-PA 152 CG17300-PA 1..133 1..137 245 43.3 Plus