Clone RE36503 Report

Search the DGRC for RE36503

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:365
Well:3
Vector:pFlc-1
Associated Gene/TranscriptNpc2b-RA
Protein status:RE36503.pep: gold
Preliminary Size:814
Sequenced Size:815

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3153 2002-01-01 Sim4 clustering to Release 2
CG3153 2002-02-26 Blastp of sequenced clone
CG3153 2003-01-01 Sim4 clustering to Release 3
CG3153 2008-04-29 Release 5.5 accounting
CG3153 2008-08-15 Release 5.9 accounting
CG3153 2008-12-18 5.12 accounting

Clone Sequence Records

RE36503.complete Sequence

815 bp (815 high quality bases) assembled on 2002-02-26

GenBank Submission: AY084159

> RE36503.complete
CAGTTTCATTTCAAGCTCCAAACGTTGCAGTTGCGCGTTAAAACACTTAT
TCAAAATCAAACAAAAAAAAGTTTTAACCACAACAACATCATCAGAATGA
AGCTGAGCTTAGGATTATTTGTGATCTTCGCCGCTTTGATCGGCTTCACG
TCGTCCACGGATGTGAGTCAGTGCCCGAAATCCAAATCGAAGGCCCTAGC
TGCCGGTGACGTCTCCATTTCCAATTGCCCCAAGAGCAAGTGCATCCTGA
AGCGCAACACGGAGGCCAGCATTCAGATGAAGATCCGGCCGGAGCGCGAC
TTCCAGGAGCTGACCTCCGACATCCAGGGCATTATCCTGGACGTGCCGCT
GCCGTTCCCAGGATATTACGGCACCAGCGCCTGTCCGCACATCTACGACG
AGGCTGGCGAGAAGAAGGTGGGCTGCCCACTGAAGGCCGGCCAGGTGTAC
ACCTACAAGAACAGCTTCAAGATCCTGCCCGTCTACCCGACCGTCAGTTT
GGAGATCCACTGGGGATTGGGCGATAAGCATGGGGATGCGGCCTGCTTCC
AGATACCCGCCAAAATCAAGGCTTAAAATACAAATGCGGACAAGTGCACT
CAATGTTAGCTTTTATTAGTGGTAATTCTTAAGATCGTATCTGCGTATCT
GCATATGCTTAGTTTAGGGATTAAGTACGGTTAAGTGAACGAAAACGAAG
CAGGCCATTATTGCGGCATCCAGCCAGTGACGCAATATGGCCAAAGGATT
CCACTGATCGGCTCAGTAAGTCTAATAATAAAAAACCACAACGAATTCGA
AAAAAAAAAAAAAAA

RE36503.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:23:41
Subject Length Description Subject Range Query Range Score Percent Strand
Npc2b-RB 935 Npc2b-RB 60..857 1..798 3990 100 Plus
Npc2b.b 831 Npc2b.b 107..829 76..798 3615 100 Plus
Npc2b.a 845 Npc2b.a 123..843 78..798 3605 100 Plus
Npc2b.a 845 Npc2b.a 1..69 9..77 345 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:39:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9916688..9917304 182..798 3085 100 Plus
chr3R 27901430 chr3R 9916172..9916279 74..181 525 99.1 Plus
chr3R 27901430 chr3R 9914401..9914477 1..77 385 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:52:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:39:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14091809..14092425 182..798 3085 100 Plus
3R 32079331 3R 14091294..14091401 74..181 525 99.1 Plus
3R 32079331 3R 14089523..14089599 1..77 385 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:52:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13832640..13833256 182..798 3085 100 Plus
3R 31820162 3R 13832125..13832232 74..181 525 99 Plus
3R 31820162 3R 13830354..13830430 1..77 385 100 Plus
Blast to na_te.dros performed on 2019-03-16 13:39:04 has no hits.

RE36503.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:40:05 Download gff for RE36503.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9914401..9914477 1..77 100 -> Plus
chr3R 9916176..9916279 78..181 100 -> Plus
chr3R 9916688..9917304 182..799 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:12:35 Download gff for RE36503.complete
Subject Subject Range Query Range Percent Splice Strand
CG3153-RA 1..480 97..576 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:34:13 Download gff for RE36503.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2b-RA 1..480 97..576 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:01:49 Download gff for RE36503.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2b-RB 1..480 97..576 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:06:25 Download gff for RE36503.complete
Subject Subject Range Query Range Percent Splice Strand
CG3153-RA 1..480 97..576 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:16:29 Download gff for RE36503.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2b-RB 1..480 97..576 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:59:58 Download gff for RE36503.complete
Subject Subject Range Query Range Percent Splice Strand
CG3153-RB 1..798 1..799 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:34:13 Download gff for RE36503.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2b-RB 1..798 1..798 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:01:49 Download gff for RE36503.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2b-RB 7..804 1..798 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:06:25 Download gff for RE36503.complete
Subject Subject Range Query Range Percent Splice Strand
CG3153-RB 1..798 1..799 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:16:29 Download gff for RE36503.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2b-RB 7..804 1..798 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:40:05 Download gff for RE36503.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14089523..14089599 1..77 100 -> Plus
3R 14091298..14091401 78..181 100 -> Plus
3R 14091809..14092425 182..799 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:40:05 Download gff for RE36503.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14089523..14089599 1..77 100 -> Plus
3R 14091298..14091401 78..181 100 -> Plus
3R 14091809..14092425 182..799 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:40:05 Download gff for RE36503.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14089523..14089599 1..77 100 -> Plus
3R 14091298..14091401 78..181 100 -> Plus
3R 14091809..14092425 182..799 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:01:49 Download gff for RE36503.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9915245..9915321 1..77 100 -> Plus
arm_3R 9917020..9917123 78..181 100 -> Plus
arm_3R 9917531..9918147 182..799 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:40:15 Download gff for RE36503.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13832640..13833256 182..799 99   Plus
3R 13830354..13830430 1..77 100 -> Plus
3R 13832129..13832232 78..181 100 -> Plus

RE36503.hyp Sequence

Translation from 0 to 575

> RE36503.hyp
QFHFKLQTLQLRVKTLIQNQTKKSFNHNNIIRMKLSLGLFVIFAALIGFT
SSTDVSQCPKSKSKALAAGDVSISNCPKSKCILKRNTEASIQMKIRPERD
FQELTSDIQGIILDVPLPFPGYYGTSACPHIYDEAGEKKVGCPLKAGQVY
TYKNSFKILPVYPTVSLEIHWGLGDKHGDAACFQIPAKIKA*

RE36503.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:59:50
Subject Length Description Subject Range Query Range Score Percent Strand
Npc2b-PA 159 CG3153-PA 1..159 33..191 836 100 Plus
Npc2b-PB 159 CG3153-PB 1..159 33..191 836 100 Plus
Npc2a-PA 148 CG7291-PA 10..148 44..190 178 32.7 Plus

RE36503.pep Sequence

Translation from 96 to 575

> RE36503.pep
MKLSLGLFVIFAALIGFTSSTDVSQCPKSKSKALAAGDVSISNCPKSKCI
LKRNTEASIQMKIRPERDFQELTSDIQGIILDVPLPFPGYYGTSACPHIY
DEAGEKKVGCPLKAGQVYTYKNSFKILPVYPTVSLEIHWGLGDKHGDAAC
FQIPAKIKA*

RE36503.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:02:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16235-PA 162 GF16235-PA 10..162 7..159 722 86.9 Plus
Dana\GF14593-PA 148 GF14593-PA 10..148 12..158 187 33.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:02:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16835-PA 159 GG16835-PA 1..159 1..159 800 95 Plus
Dere\GG24820-PA 148 GG24820-PA 10..148 12..158 182 33.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:02:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25061-PA 160 GH25061-PA 1..160 1..159 712 82.5 Plus
Dgri\GH22453-PA 160 GH22453-PA 1..160 1..159 712 82.5 Plus
Dgri\GH25210-PA 150 GH25210-PA 28..150 31..158 155 31.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:07:13
Subject Length Description Subject Range Query Range Score Percent Strand
Npc2b-PA 159 CG3153-PA 1..159 1..159 836 100 Plus
Npc2b-PB 159 CG3153-PB 1..159 1..159 836 100 Plus
Npc2a-PA 148 CG7291-PA 10..148 12..158 178 32.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:02:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23038-PA 159 GI23038-PA 1..159 1..159 693 79.2 Plus
Dmoj\GI17283-PA 150 GI17283-PA 36..150 39..158 163 31.7 Plus
Dmoj\GI18242-PA 150 GI18242-PA 36..150 39..158 159 32.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:02:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24236-PA 159 GL24236-PA 1..159 1..159 733 84.9 Plus
Dper\GL19668-PA 147 GL19668-PA 2..147 5..158 187 31.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:02:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16304-PA 159 GA16304-PA 1..159 1..159 734 85.5 Plus
Dpse\GA20242-PA 147 GA20242-PA 2..147 5..158 187 31.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:02:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24149-PA 159 GM24149-PA 1..159 1..159 829 98.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:02:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18945-PA 159 GD18945-PA 1..159 1..159 824 98.1 Plus
Dsim\GD23124-PA 148 GD23124-PA 10..148 12..158 187 31.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:02:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24627-PA 157 GJ24627-PA 17..157 19..159 673 85.8 Plus
Dvir\GJ22897-PA 150 GJ22897-PA 36..150 39..158 163 32.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:02:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12189-PA 160 GK12189-PA 1..160 1..159 698 81.2 Plus
Dwil\GK24197-PA 149 GK24197-PA 12..149 7..158 177 33.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:02:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24217-PA 159 GE24217-PA 1..159 1..159 801 95.6 Plus
Dyak\GE17856-PA 148 GE17856-PA 10..148 12..158 187 32.4 Plus