BDGP Sequence Production Resources |
Search the DGRC for RE36503
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 365 |
Well: | 3 |
Vector: | pFlc-1 |
Associated Gene/Transcript | Npc2b-RA |
Protein status: | RE36503.pep: gold |
Preliminary Size: | 814 |
Sequenced Size: | 815 |
Gene | Date | Evidence |
---|---|---|
CG3153 | 2002-01-01 | Sim4 clustering to Release 2 |
CG3153 | 2002-02-26 | Blastp of sequenced clone |
CG3153 | 2003-01-01 | Sim4 clustering to Release 3 |
CG3153 | 2008-04-29 | Release 5.5 accounting |
CG3153 | 2008-08-15 | Release 5.9 accounting |
CG3153 | 2008-12-18 | 5.12 accounting |
815 bp (815 high quality bases) assembled on 2002-02-26
GenBank Submission: AY084159
> RE36503.complete CAGTTTCATTTCAAGCTCCAAACGTTGCAGTTGCGCGTTAAAACACTTAT TCAAAATCAAACAAAAAAAAGTTTTAACCACAACAACATCATCAGAATGA AGCTGAGCTTAGGATTATTTGTGATCTTCGCCGCTTTGATCGGCTTCACG TCGTCCACGGATGTGAGTCAGTGCCCGAAATCCAAATCGAAGGCCCTAGC TGCCGGTGACGTCTCCATTTCCAATTGCCCCAAGAGCAAGTGCATCCTGA AGCGCAACACGGAGGCCAGCATTCAGATGAAGATCCGGCCGGAGCGCGAC TTCCAGGAGCTGACCTCCGACATCCAGGGCATTATCCTGGACGTGCCGCT GCCGTTCCCAGGATATTACGGCACCAGCGCCTGTCCGCACATCTACGACG AGGCTGGCGAGAAGAAGGTGGGCTGCCCACTGAAGGCCGGCCAGGTGTAC ACCTACAAGAACAGCTTCAAGATCCTGCCCGTCTACCCGACCGTCAGTTT GGAGATCCACTGGGGATTGGGCGATAAGCATGGGGATGCGGCCTGCTTCC AGATACCCGCCAAAATCAAGGCTTAAAATACAAATGCGGACAAGTGCACT CAATGTTAGCTTTTATTAGTGGTAATTCTTAAGATCGTATCTGCGTATCT GCATATGCTTAGTTTAGGGATTAAGTACGGTTAAGTGAACGAAAACGAAG CAGGCCATTATTGCGGCATCCAGCCAGTGACGCAATATGGCCAAAGGATT CCACTGATCGGCTCAGTAAGTCTAATAATAAAAAACCACAACGAATTCGA AAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Npc2b-RB | 935 | Npc2b-RB | 60..857 | 1..798 | 3990 | 100 | Plus |
Npc2b.b | 831 | Npc2b.b | 107..829 | 76..798 | 3615 | 100 | Plus |
Npc2b.a | 845 | Npc2b.a | 123..843 | 78..798 | 3605 | 100 | Plus |
Npc2b.a | 845 | Npc2b.a | 1..69 | 9..77 | 345 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 9916688..9917304 | 182..798 | 3085 | 100 | Plus |
chr3R | 27901430 | chr3R | 9916172..9916279 | 74..181 | 525 | 99.1 | Plus |
chr3R | 27901430 | chr3R | 9914401..9914477 | 1..77 | 385 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 9914401..9914477 | 1..77 | 100 | -> | Plus |
chr3R | 9916176..9916279 | 78..181 | 100 | -> | Plus |
chr3R | 9916688..9917304 | 182..799 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG3153-RA | 1..480 | 97..576 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Npc2b-RA | 1..480 | 97..576 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Npc2b-RB | 1..480 | 97..576 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG3153-RA | 1..480 | 97..576 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Npc2b-RB | 1..480 | 97..576 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG3153-RB | 1..798 | 1..799 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Npc2b-RB | 1..798 | 1..798 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Npc2b-RB | 7..804 | 1..798 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG3153-RB | 1..798 | 1..799 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Npc2b-RB | 7..804 | 1..798 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 14089523..14089599 | 1..77 | 100 | -> | Plus |
3R | 14091298..14091401 | 78..181 | 100 | -> | Plus |
3R | 14091809..14092425 | 182..799 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 14089523..14089599 | 1..77 | 100 | -> | Plus |
3R | 14091298..14091401 | 78..181 | 100 | -> | Plus |
3R | 14091809..14092425 | 182..799 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 14089523..14089599 | 1..77 | 100 | -> | Plus |
3R | 14091298..14091401 | 78..181 | 100 | -> | Plus |
3R | 14091809..14092425 | 182..799 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 9915245..9915321 | 1..77 | 100 | -> | Plus |
arm_3R | 9917020..9917123 | 78..181 | 100 | -> | Plus |
arm_3R | 9917531..9918147 | 182..799 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 13832640..13833256 | 182..799 | 99 | Plus | |
3R | 13830354..13830430 | 1..77 | 100 | -> | Plus |
3R | 13832129..13832232 | 78..181 | 100 | -> | Plus |
Translation from 0 to 575
> RE36503.hyp QFHFKLQTLQLRVKTLIQNQTKKSFNHNNIIRMKLSLGLFVIFAALIGFT SSTDVSQCPKSKSKALAAGDVSISNCPKSKCILKRNTEASIQMKIRPERD FQELTSDIQGIILDVPLPFPGYYGTSACPHIYDEAGEKKVGCPLKAGQVY TYKNSFKILPVYPTVSLEIHWGLGDKHGDAACFQIPAKIKA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Npc2b-PA | 159 | CG3153-PA | 1..159 | 33..191 | 836 | 100 | Plus |
Npc2b-PB | 159 | CG3153-PB | 1..159 | 33..191 | 836 | 100 | Plus |
Npc2a-PA | 148 | CG7291-PA | 10..148 | 44..190 | 178 | 32.7 | Plus |
Translation from 96 to 575
> RE36503.pep MKLSLGLFVIFAALIGFTSSTDVSQCPKSKSKALAAGDVSISNCPKSKCI LKRNTEASIQMKIRPERDFQELTSDIQGIILDVPLPFPGYYGTSACPHIY DEAGEKKVGCPLKAGQVYTYKNSFKILPVYPTVSLEIHWGLGDKHGDAAC FQIPAKIKA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16235-PA | 162 | GF16235-PA | 10..162 | 7..159 | 722 | 86.9 | Plus |
Dana\GF14593-PA | 148 | GF14593-PA | 10..148 | 12..158 | 187 | 33.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16835-PA | 159 | GG16835-PA | 1..159 | 1..159 | 800 | 95 | Plus |
Dere\GG24820-PA | 148 | GG24820-PA | 10..148 | 12..158 | 182 | 33.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH25061-PA | 160 | GH25061-PA | 1..160 | 1..159 | 712 | 82.5 | Plus |
Dgri\GH22453-PA | 160 | GH22453-PA | 1..160 | 1..159 | 712 | 82.5 | Plus |
Dgri\GH25210-PA | 150 | GH25210-PA | 28..150 | 31..158 | 155 | 31.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Npc2b-PA | 159 | CG3153-PA | 1..159 | 1..159 | 836 | 100 | Plus |
Npc2b-PB | 159 | CG3153-PB | 1..159 | 1..159 | 836 | 100 | Plus |
Npc2a-PA | 148 | CG7291-PA | 10..148 | 12..158 | 178 | 32.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23038-PA | 159 | GI23038-PA | 1..159 | 1..159 | 693 | 79.2 | Plus |
Dmoj\GI17283-PA | 150 | GI17283-PA | 36..150 | 39..158 | 163 | 31.7 | Plus |
Dmoj\GI18242-PA | 150 | GI18242-PA | 36..150 | 39..158 | 159 | 32.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24236-PA | 159 | GL24236-PA | 1..159 | 1..159 | 733 | 84.9 | Plus |
Dper\GL19668-PA | 147 | GL19668-PA | 2..147 | 5..158 | 187 | 31.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA16304-PA | 159 | GA16304-PA | 1..159 | 1..159 | 734 | 85.5 | Plus |
Dpse\GA20242-PA | 147 | GA20242-PA | 2..147 | 5..158 | 187 | 31.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM24149-PA | 159 | GM24149-PA | 1..159 | 1..159 | 829 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD18945-PA | 159 | GD18945-PA | 1..159 | 1..159 | 824 | 98.1 | Plus |
Dsim\GD23124-PA | 148 | GD23124-PA | 10..148 | 12..158 | 187 | 31.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ24627-PA | 157 | GJ24627-PA | 17..157 | 19..159 | 673 | 85.8 | Plus |
Dvir\GJ22897-PA | 150 | GJ22897-PA | 36..150 | 39..158 | 163 | 32.5 | Plus |