Clone RE36566 Report

Search the DGRC for RE36566

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:365
Well:66
Vector:pFlc-1
Associated Gene/TranscriptCG42819-RA
Protein status:RE36566.pep: gold
Sequenced Size:616

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG41819-RA 2011-02-22 Manual selection by Sue Celniker

Clone Sequence Records

RE36566.complete Sequence

616 bp assembled on 2011-03-18

GenBank Submission: BT126229.1

> RE36566.complete
ATCAATCAATCAACAACGGTTCCCTCATAAGTTCGTGTATCTCTTGCGTC
AAAGCCAATATGCGCAGCTACGTGAAGTCATCCTGTTCCTTGCTGGTTCT
GGTCCTGGCACTTGGAGCGGTTTCAGCTCAGCCAGCACGGCTGGCAAAGC
AACTTCAGAAACAGCAGGCAGCACCCTATCCATCCGCCGACGAACTGAAG
CCGGAGGTGCCATTCGAGGAAGGAGTTCCGGATCAGACATATGGACCACC
GGATCTGACCTACGGCCCACCGCCTACCGATGCAGTTGAGCAGCTACCCA
GCGATGAGGAGCCGCAAGACTTTACACCCGATCCGGATGCAGAGGAAGTT
CAGCCTGTCCAGCAGGCACCCGCTCGCCTGACCAAGCAGATTAGGAACGG
TCCACGAGCTCAAGGACTGATTCTGCTCTCATCGAGTCCATTGAGAGTGG
CTAATTCCAATGGAATCCCATTCCCAGTGACCATTCAAGCCCTGTGGTAG
GAATACTAAATAACATCAATTGTACTGATTTTTATAAACATTATATTAAT
TATTGTCTTTGTTACCGATTGAACTATTAAAGAACATTTGTTGATACACC
GAAAAAAAAAAAAAAA

RE36566.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:33:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8387638..8388238 601..1 2885 98.7 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:33:21
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8388726..8389328 603..1 3015 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:09:03
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8388726..8389328 603..1 3015 100 Minus
Blast to na_te.dros performed 2019-03-16 22:33:21
Subject Length Description Subject Range Query Range Score Percent Strand
TAHRE 10463 TAHRE OSV 10463bp 6776..6835 564..507 114 70 Minus

RE36566.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:34:06 Download gff for RE36566.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8387638..8388238 1..601 98   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-22 17:53:23 Download gff for RE36566.complete
Subject Subject Range Query Range Percent Splice Strand
CG42819-RA 1..441 60..500 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:57:54 Download gff for RE36566.complete
Subject Subject Range Query Range Percent Splice Strand
CG42819-RA 1..441 60..500 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:30:11 Download gff for RE36566.complete
Subject Subject Range Query Range Percent Splice Strand
CG42819-RA 1..441 60..500 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-22 17:53:23 Download gff for RE36566.complete
Subject Subject Range Query Range Percent Splice Strand
CG42819-RA 1..577 25..601 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:57:54 Download gff for RE36566.complete
Subject Subject Range Query Range Percent Splice Strand
CG42819-RA 4..604 1..601 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:30:11 Download gff for RE36566.complete
Subject Subject Range Query Range Percent Splice Strand
CG42819-RA 4..604 1..601 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:34:06 Download gff for RE36566.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8388728..8389328 1..601 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:34:06 Download gff for RE36566.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8388728..8389328 1..601 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:34:06 Download gff for RE36566.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8388728..8389328 1..601 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:57:54 Download gff for RE36566.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8388728..8389328 1..601 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:02:10 Download gff for RE36566.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8388728..8389328 1..601 100   Minus

RE36566.hyp Sequence

Translation from 2 to 499

> RE36566.hyp
QSINNGSLISSCISCVKANMRSYVKSSCSLLVLVLALGAVSAQPARLAKQ
LQKQQAAPYPSADELKPEVPFEEGVPDQTYGPPDLTYGPPPTDAVEQLPS
DEEPQDFTPDPDAEEVQPVQQAPARLTKQIRNGPRAQGLILLSSSPLRVA
NSNGIPFPVTIQALW*

RE36566.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:09:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG42819-PA 146 CG42819-PA 1..146 20..165 754 100 Plus

RE36566.pep Sequence

Translation from 2 to 499

> RE36566.pep
QSINNGSLISSCISCVKANMRSYVKSSCSLLVLVLALGAVSAQPARLAKQ
LQKQQAAPYPSADELKPEVPFEEGVPDQTYGPPDLTYGPPPTDAVEQLPS
DEEPQDFTPDPDAEEVQPVQQAPARLTKQIRNGPRAQGLILLSSSPLRVA
NSNGIPFPVTIQALW*

RE36566.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:25:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14681-PA 852 GF14681-PA 705..852 18..165 579 72.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:25:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23446-PA 146 GG23446-PA 1..146 20..165 701 94.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG42819-PA 146 CG42819-PA 1..146 20..165 754 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:25:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25807-PA 144 GL25807-PA 1..144 20..165 532 71.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:25:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25455-PA 144 GA25455-PA 1..144 20..165 529 71.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:25:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12983-PA 825 GM12983-PA 679..825 19..165 746 98 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:25:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22409-PA 826 GD22409-PA 680..826 19..165 751 98.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:25:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18688-PA 720 GK18688-PA 560..699 19..144 363 60 Plus
Dwil\GK18926-PA 159 GK18926-PA 1..138 20..144 361 60.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:25:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11023-PA 145 GE11023-PA 1..145 20..165 682 93.8 Plus