Clone RE36735 Report

Search the DGRC for RE36735

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:367
Well:35
Vector:pFlc-1
Associated Gene/TranscripteIF-4E-RC
Protein status:RE36735.pep: gold
Sequenced Size:1169

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4035 2004-03-31 Blastp of sequenced clone
eIF-4E 2008-04-29 Release 5.5 accounting
eIF-4E 2008-08-15 Release 5.9 accounting
eIF-4E 2008-12-18 5.12 accounting

Clone Sequence Records

RE36735.complete Sequence

1169 bp (1169 high quality bases) assembled on 2004-03-31

GenBank Submission: BT012467

> RE36735.complete
ACTAACTTTCCTTTAGGCAACGGCCACACTGTCTGGCCACCAAAATCCCA
AACTTAATTAAAGAATTAAATAATTCGAATAATAATTAAGCCCAGTAACC
TACGCAGCTTGAGTGCGTAACCGATATCTAGTATACATTTCGATACATCG
AAATCATGGTAGTGTTGGAGACGGAGAAGACCAGCGCCCCCAGCACCGAG
CAGGGTCGTCCGGAACCACCAACTTCGGCTGCAGCGCCCGCCGAGGCTAA
GGATGTCAAGCCCAAGGAGGACCCACAGGAGACTGGTGAACCAGCAGGCA
ACACTGCAACCACTACTGCTCCTGCCGGCGACGATGCTGTGCGCACCGAG
CATTTATACAAACACCCGCTCATGAATGTCTGGACGCTGTGGTACCTTGA
AAACGATCGGTCCAAGTCCTGGGAGGACATGCAAAACGAGATCACCAGCT
TCGATACCGTCGAGGACTTCTGGAGCCTATACAACCACATCAAGCCCCCA
TCAGAGATCAAGCTGGGTAGTGACTACTCGCTATTCAAGAAGAACATTCG
TCCCATGTGGGAGGATGCAGCCAACAAACAGGGCGGTCGTTGGGTCATTA
CCCTTAACAAAAGCTCCAAGACCGATCTGGATAACCTATGGCTCGATGTG
CTGCTCTGCCTGATTGGTGAGGCCTTCGATCACTCTGATCAGATCTGCGG
CGCTGTTATAAACATTCGCGGCAAGAGCAACAAGATATCCATCTGGACTG
CCGACGGAAACAACGAGGAAGCTGCCCTTGAGATTGGTCACAAGCTGCGC
GATGCCCTGCGTCTGGGACGCAACAACTCGCTGCAGTATCAGTTGCACAA
GGACACGATGGTCAAGCAGGGCTCCAACGTGAAATCGATCTACACTTTGT
AGGCGGCTAATAACTGGCCGCTCCTTATTCGGTCCGATCCCACACTGATT
ATTTTGTCTTTCATTTATTTATCGTTATAAGCAACAGTAGCGATTAATCG
TGACTATTGTCTAAGACCCGCGTAACGAAACCGAAACGGAACCCCCTTTG
TTATCAAAAATCGGCATAATATAAAATCTATCCGCTTTTTGTAGTCACTG
TCAATAATGGATTAGACGGAAAAGTATATTAATAAAAACCTACATTAAAA
CCGAAAAAAAAAAAAAAAA

RE36735.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:02:44
Subject Length Description Subject Range Query Range Score Percent Strand
eIF-4E-RC 1453 eIF-4E-RC 255..1407 1..1153 5765 100 Plus
eIF-4E-RB 1603 eIF-4E-RB 584..1557 180..1153 4870 100 Plus
eIF-4E-RD 1851 eIF-4E-RD 832..1805 180..1153 4870 100 Plus
eIF-4E-RB 1603 eIF-4E-RB 77..255 1..179 895 100 Plus
eIF-4E-RD 1851 eIF-4E-RD 86..264 1..179 895 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:17:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 9391516..9391930 1153..739 2000 98.8 Minus
chr3L 24539361 chr3L 9392480..9392852 550..178 1865 100 Minus
chr3L 24539361 chr3L 9394188..9394366 179..1 880 99.4 Minus
chr3L 24539361 chr3L 9392316..9392416 650..550 490 99 Minus
chr3L 24539361 chr3L 9391994..9392082 738..650 430 98.9 Minus
chrX 22417052 chrX 1052926..1053303 757..380 390 73.5 Minus
chr3R 27901430 chr3R 24849489..24849817 748..420 310 72.9 Minus
chr3L 24539361 chr3L 6657539..6657707 549..381 290 78.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:52:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:17:45
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9399619..9400033 1153..739 2075 100 Minus
3L 28110227 3L 9400583..9400955 550..178 1865 100 Minus
3L 28110227 3L 9402280..9402458 179..1 895 100 Minus
3L 28110227 3L 9400419..9400519 650..550 505 100 Minus
3L 28110227 3L 9400097..9400185 738..650 445 100 Minus
X 23542271 X 1158961..1159338 757..380 390 73.5 Minus
3R 32079331 3R 29026520..29026848 748..420 325 73.3 Minus
3L 28110227 3L 6665168..6665336 549..381 290 78.1 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:50:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 9392719..9393133 1153..739 2075 100 Minus
3L 28103327 3L 9393683..9394055 550..178 1865 100 Minus
3L 28103327 3L 9395380..9395558 179..1 895 100 Minus
3L 28103327 3L 9393519..9393619 650..550 505 100 Minus
3L 28103327 3L 9393197..9393285 738..650 445 100 Minus
X 23527363 X 1167242..1167369 574..447 325 83.5 Minus
3L 28103327 3L 6658268..6658436 549..381 290 78.1 Minus
3R 31820162 3R 28767533..28767679 566..420 255 78.2 Minus
3L 28103327 3L 6657952..6658025 733..660 145 79.7 Minus
Blast to na_te.dros performed on 2019-03-16 12:17:45 has no hits.

RE36735.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:18:51 Download gff for RE36735.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 9391516..9391930 739..1153 98 <- Minus
chr3L 9391994..9392081 651..738 98 <- Minus
chr3L 9392316..9392415 551..650 99 <- Minus
chr3L 9392480..9392850 180..550 100 <- Minus
chr3L 9394188..9394366 1..179 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:12:45 Download gff for RE36735.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-4E-RC 1..747 156..902 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:38:03 Download gff for RE36735.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-4E-RC 1..747 156..902 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:05:29 Download gff for RE36735.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-4E-RC 1..747 156..902 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:21:50 Download gff for RE36735.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-4E-RC 1..747 156..902 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:41:57 Download gff for RE36735.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-4E-RC 1..747 156..902 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:45:58 Download gff for RE36735.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-4E-RC 8..1160 1..1153 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:38:03 Download gff for RE36735.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-4E-RC 8..1160 1..1153 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:05:29 Download gff for RE36735.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-4E-RC 3..1155 1..1153 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:21:50 Download gff for RE36735.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-4E-RC 8..1160 1..1153 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:41:57 Download gff for RE36735.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-4E-RC 3..1155 1..1153 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:18:51 Download gff for RE36735.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9399619..9400033 739..1153 100 <- Minus
3L 9400097..9400184 651..738 100 <- Minus
3L 9400419..9400518 551..650 100 <- Minus
3L 9400583..9400953 180..550 100 <- Minus
3L 9402280..9402458 1..179 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:18:51 Download gff for RE36735.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9399619..9400033 739..1153 100 <- Minus
3L 9400097..9400184 651..738 100 <- Minus
3L 9400419..9400518 551..650 100 <- Minus
3L 9400583..9400953 180..550 100 <- Minus
3L 9402280..9402458 1..179 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:18:51 Download gff for RE36735.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9399619..9400033 739..1153 100 <- Minus
3L 9400097..9400184 651..738 100 <- Minus
3L 9400419..9400518 551..650 100 <- Minus
3L 9400583..9400953 180..550 100 <- Minus
3L 9402280..9402458 1..179 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:05:29 Download gff for RE36735.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9392719..9393133 739..1153 100 <- Minus
arm_3L 9393197..9393284 651..738 100 <- Minus
arm_3L 9393519..9393618 551..650 100 <- Minus
arm_3L 9393683..9394053 180..550 100 <- Minus
arm_3L 9395380..9395558 1..179 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:59:17 Download gff for RE36735.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9392719..9393133 739..1153 100 <- Minus
3L 9393197..9393284 651..738 100 <- Minus
3L 9393519..9393618 551..650 100 <- Minus
3L 9393683..9394053 180..550 100 <- Minus
3L 9395380..9395558 1..179 100   Minus

RE36735.pep Sequence

Translation from 155 to 901

> RE36735.pep
MVVLETEKTSAPSTEQGRPEPPTSAAAPAEAKDVKPKEDPQETGEPAGNT
ATTTAPAGDDAVRTEHLYKHPLMNVWTLWYLENDRSKSWEDMQNEITSFD
TVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDAANKQGGRWVITL
NKSSKTDLDNLWLDVLLCLIGEAFDHSDQICGAVINIRGKSNKISIWTAD
GNNEEAALEIGHKLRDALRLGRNNSLQYQLHKDTMVKQGSNVKSIYTL*

RE36735.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:28:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23736-PA 261 GF23736-PA 19..261 8..248 1022 79.6 Plus
Dana\GF22031-PA 458 GF22031-PA 247..458 20..248 788 65.5 Plus
Dana\GF10894-PA 230 GF10894-PA 51..230 68..248 745 75.1 Plus
Dana\GF10327-PA 271 GF10327-PA 92..271 68..248 655 64.1 Plus
Dana\GF25106-PA 244 GF25106-PA 66..244 69..248 590 56.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:28:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14044-PA 250 GG14044-PA 1..250 1..248 1216 92.8 Plus
Dere\GG15032-PA 229 GG15032-PA 51..229 69..248 742 75.6 Plus
Dere\GG12718-PA 448 GG12718-PA 254..448 53..248 741 67.9 Plus
Dere\GG14453-PA 231 GG14453-PA 52..231 68..248 648 65.2 Plus
Dere\GG14292-PA 244 GG14292-PA 66..244 69..248 582 55 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:28:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16860-PA 275 GH16860-PA 85..275 58..248 956 91.1 Plus
Dgri\GH15637-PA 233 GH15637-PA 17..233 20..248 709 61.1 Plus
Dgri\GH24331-PA 222 GH24331-PA 41..222 67..248 676 64.8 Plus
Dgri\GH14978-PA 232 GH14978-PA 3..232 23..248 651 52.8 Plus
Dgri\GH12729-PA 300 GH12729-PA 109..300 60..248 613 59.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:09:08
Subject Length Description Subject Range Query Range Score Percent Strand
eIF4E1-PC 248 CG4035-PC 1..248 1..248 1321 100 Plus
eIF4E1-PI 259 CG4035-PI 19..259 8..248 1289 100 Plus
eIF4E1-PH 259 CG4035-PH 19..259 8..248 1289 100 Plus
eIF4E1-PD 259 CG4035-PD 19..259 8..248 1289 100 Plus
eIF4E1-PB 259 CG4035-PB 19..259 8..248 1289 100 Plus
eIF4E1-PF 259 CG4035-PF 19..259 8..248 1289 100 Plus
eIF4E1-PE 259 CG4035-PE 19..259 8..248 1289 100 Plus
eIF4E1-PG 259 CG4035-PG 19..259 8..248 1289 100 Plus
eIF4E1-PA 259 CG4035-PA 19..259 8..248 1289 100 Plus
eIF4E4-PA 229 CG10124-PA 51..227 69..246 724 74.7 Plus
eIF4E7-PA 429 CG32859-PA 250..429 69..248 672 67.8 Plus
eIF4E5-PA 232 CG8277-PA 2..232 25..248 665 53.8 Plus
eIF4E3-PA 244 CG8023-PA 66..244 69..248 614 58.3 Plus
eIF4E6-PC 173 CG1442-PC 32..168 69..204 448 60.6 Plus
eIF4E6-PB 173 CG1442-PB 32..168 69..204 448 60.6 Plus
eIF4E6-PA 173 CG1442-PA 32..168 69..204 448 60.6 Plus
eIF4EHP-PA 223 CG33100-PA 48..211 72..235 258 29.9 Plus
eIF4EHP-PD 242 CG33100-PD 48..211 72..235 258 29.9 Plus
eIF4EHP-PB 248 CG33100-PB 48..172 72..196 210 32 Plus
eIF4EHP-PC 186 CG33100-PC 48..164 72..188 208 33.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:28:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12684-PA 246 GI12684-PA 67..246 68..248 721 72.9 Plus
Dmoj\GI14982-PA 311 GI14982-PA 106..310 45..247 719 66.3 Plus
Dmoj\GI13141-PA 238 GI13141-PA 59..238 68..248 638 62.4 Plus
Dmoj\GI13083-PA 125 GI13083-PA 43..125 166..248 415 91.6 Plus
Dmoj\GI16776-PA 198 GI16776-PA 98..162 68..132 231 58.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:28:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12850-PA 198 GL12850-PA 8..198 56..248 972 94.3 Plus
Dper\GL13241-PA 223 GL13241-PA 45..223 69..248 701 69.4 Plus
Dper\GL26506-PA 219 GL26506-PA 16..219 48..248 550 50.2 Plus
Dper\GL14400-PA 233 GL14400-PA 22..233 33..248 546 48.1 Plus
Dper\GL18042-PA 204 GL18042-PA 16..204 32..248 400 41.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:28:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28658-PA 263 GA28658-PA 19..263 8..248 1001 80.5 Plus
Dpse\GA28599-PA 223 GA28599-PA 45..223 69..248 706 70 Plus
Dpse\GA28380-PA 227 GA28380-PA 23..227 35..248 651 59.8 Plus
Dpse\GA24628-PA 234 GA24628-PA 52..234 65..248 595 56.5 Plus
Dpse\GA23005-PA 233 GA23005-PA 22..233 33..248 554 49.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:28:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24878-PA 269 GM24878-PA 1..269 1..248 1272 90.7 Plus
Dsec\GM13832-PA 229 GM13832-PA 51..229 69..248 726 73.9 Plus
Dsec\GM18997-PA 422 GM18997-PA 243..422 69..248 666 64.4 Plus
Dsec\GM25004-PA 233 GM25004-PA 2..233 25..248 642 52.3 Plus
Dsec\GM25034-PA 244 GM25034-PA 66..244 69..248 598 57.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:28:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12928-PA 269 GD12928-PA 1..269 1..248 1270 90.7 Plus
Dsim\GD13118-PA 229 GD13118-PA 51..229 69..248 725 73.9 Plus
Dsim\GD14038-PA 233 GD14038-PA 2..233 25..248 641 51.5 Plus
Dsim\GD14067-PA 244 GD14067-PA 66..244 69..248 598 57.2 Plus
Dsim\GD16435-PA 420 GD16435-PA 248..389 69..210 573 67.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:28:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13832-PA 272 GJ13832-PA 28..272 5..248 980 78.4 Plus
Dvir\GJ19475-PA 323 GJ19475-PA 94..323 22..248 899 75.7 Plus
Dvir\GJ12668-PA 230 GJ12668-PA 51..230 68..248 721 72.9 Plus
Dvir\GJ16331-PA 301 GJ16331-PA 92..300 40..247 713 65.4 Plus
Dvir\GJ13889-PA 238 GJ13889-PA 59..238 68..248 644 62.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:28:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20927-PA 266 GK20927-PA 33..266 17..248 1005 80.9 Plus
Dwil\GK25580-PA 300 GK25580-PA 114..300 62..248 872 82.9 Plus
Dwil\GK12168-PA 260 GK12168-PA 34..260 19..248 832 66.5 Plus
Dwil\GK14373-PA 235 GK14373-PA 57..235 69..248 820 81.7 Plus
Dwil\GK16243-PA 360 GK16243-PA 166..360 51..248 773 72.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:28:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21247-PA 269 GE21247-PA 1..269 1..248 1262 89.6 Plus
Dyak\GE16544-PA 448 GE16544-PA 248..448 47..248 744 65.8 Plus
Dyak\GE20475-PA 229 GE20475-PA 51..229 69..248 735 75 Plus
Dyak\GE21642-PA 231 GE21642-PA 2..231 25..248 664 54.5 Plus
Dyak\GE20721-PA 244 GE20721-PA 66..244 69..248 583 55.6 Plus

RE36735.hyp Sequence

Translation from 155 to 901

> RE36735.hyp
MVVLETEKTSAPSTEQGRPEPPTSAAAPAEAKDVKPKEDPQETGEPAGNT
ATTTAPAGDDAVRTEHLYKHPLMNVWTLWYLENDRSKSWEDMQNEITSFD
TVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDAANKQGGRWVITL
NKSSKTDLDNLWLDVLLCLIGEAFDHSDQICGAVINIRGKSNKISIWTAD
GNNEEAALEIGHKLRDALRLGRNNSLQYQLHKDTMVKQGSNVKSIYTL*

RE36735.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:39:51
Subject Length Description Subject Range Query Range Score Percent Strand
eIF-4E-PC 248 CG4035-PC 1..248 1..248 1321 100 Plus
eIF-4E-PI 259 CG4035-PI 19..259 8..248 1289 100 Plus
eIF-4E-PH 259 CG4035-PH 19..259 8..248 1289 100 Plus
eIF-4E-PD 259 CG4035-PD 19..259 8..248 1289 100 Plus
eIF-4E-PB 259 CG4035-PB 19..259 8..248 1289 100 Plus