Clone RE36854 Report

Search the DGRC for RE36854

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:368
Well:54
Vector:pFlc-1
Associated Gene/TranscriptRpn12-RA
Protein status:RE36854.pep: gold
Preliminary Size:989
Sequenced Size:1057

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4157 2002-01-01 Sim4 clustering to Release 2
CG4157 2002-02-22 Blastp of sequenced clone
CG4157 2003-01-01 Sim4 clustering to Release 3
Rpn12 2008-04-29 Release 5.5 accounting
Rpn12 2008-08-15 Release 5.9 accounting
Rpn12 2008-12-18 5.12 accounting

Clone Sequence Records

RE36854.complete Sequence

1057 bp (1057 high quality bases) assembled on 2002-02-22

GenBank Submission: AY084160

> RE36854.complete
TGCGATAACGATTGTCCTATCGCTTTACCCTACAACAATTGCCATCTCTA
AAAAAAAGCGAAAATCATCTTGGGAATTTGCAGAAAACATTTAAGCTTCA
ATATACCAATCTAAAGAATGGCCAACGTGGAATCGCTGTACAAAGAACTG
ACCGCCGAGTGGTCAAAGCGGCCACCAAACACCGTCAAATGCGGCCAGCT
GCTGGATCAACTGAAAGTAGCGCTCGTGAAGATGGCCTTCCTGCCGACGG
ACGGAAACGATGCCCAGAGCTCCAAGAAGCAATTGATCCTGGCTAGGAGC
GTGCTTGAGGTGGCCGTGGAGCATAGCGTGCTCAGCAAGGACCTGCTCGC
CTTCGAGCGCTACATGGCGCAGCTGAAGTGCTATTACTATGACTACGCTA
AGATCATTGGCGAATCGGAGAGCAAGTATAAGCTGCTCGGTCTGAATCTG
CTGTACCTCTTGTCTGGCAACCGGGTATCCGACTTTCACACGGAACTGGA
GCTGCTCTCCGTGGACGTCATCCAGCACAATCAGTTCATTCGGCCCATCC
TGGCGCTCGAGCAGTACATCATGGAGGGACGCTACAACAAGATCTTTCAG
GCCAAGTCGACGGTGCCCGTCGAGGTGTATAGCTACTTTATGGATCTTCT
GTTGGAAACGGTGCGCGATGAAATTGGTGCCTGCATCGAGAAGTCCTACG
ACAAGATCTCCGCCAAGGATGCAGCCAAGCGGCTCAACCTGCGCGTCCCC
GACGAGATCAAGGCCTTCGGCGCGAAGCGTCAATGGAAACTGGAGGCTAG
CGGCGACTACAGCTTCACGGACCGTAGCGTCAAACCCAAGGAGCTCCTGC
CCTCCGAGGAACTCGCCGAGCAGGTGCTCAGCTACGCCCGCGACCTCGAG
ATGATAGTTTAAGTCGCAAAGCAGCCGTTAATAAACGACAGAGTAAGGTT
AAGAAAACAGTTCTAACACGCTGGATACCACAATTTTTATAATAATATGT
AATTACATTGAAAACAACAAGAAATTAAATTTAAAACTCCCAAAAAAAAA
AAAAAAA

RE36854.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:25:18
Subject Length Description Subject Range Query Range Score Percent Strand
Rpn12-RA 1040 Rpn12-RA 3..1040 3..1040 5190 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:26:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16572754..16573791 3..1040 5190 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:52:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:26:24
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16582985..16584022 3..1040 5190 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:54:22
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16576085..16577122 3..1040 5190 100 Plus
Blast to na_te.dros performed on 2019-03-15 16:26:25 has no hits.

RE36854.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:27:06 Download gff for RE36854.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16572752..16573791 1..1041 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:12:49 Download gff for RE36854.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn12-RA 1..795 118..912 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:37:55 Download gff for RE36854.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn12-RA 1..795 118..912 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:02:29 Download gff for RE36854.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn12-RA 1..795 118..912 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:08:34 Download gff for RE36854.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn12-RA 1..795 118..912 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:36:49 Download gff for RE36854.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn12-RA 1..795 118..912 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:03:04 Download gff for RE36854.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn12-RA 1..1039 1..1039 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:37:55 Download gff for RE36854.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn12-RA 1..1040 1..1040 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:02:29 Download gff for RE36854.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn12-RA 1..995 46..1040 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:08:34 Download gff for RE36854.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn12-RA 1..1039 1..1039 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:36:49 Download gff for RE36854.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn12-RA 1..995 46..1040 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:27:06 Download gff for RE36854.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16582983..16584022 1..1041 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:27:06 Download gff for RE36854.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16582983..16584022 1..1041 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:27:06 Download gff for RE36854.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16582983..16584022 1..1041 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:02:29 Download gff for RE36854.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16576083..16577122 1..1041 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:42:38 Download gff for RE36854.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16576083..16577122 1..1041 99   Plus

RE36854.pep Sequence

Translation from 117 to 911

> RE36854.pep
MANVESLYKELTAEWSKRPPNTVKCGQLLDQLKVALVKMAFLPTDGNDAQ
SSKKQLILARSVLEVAVEHSVLSKDLLAFERYMAQLKCYYYDYAKIIGES
ESKYKLLGLNLLYLLSGNRVSDFHTELELLSVDVIQHNQFIRPILALEQY
IMEGRYNKIFQAKSTVPVEVYSYFMDLLLETVRDEIGACIEKSYDKISAK
DAAKRLNLRVPDEIKAFGAKRQWKLEASGDYSFTDRSVKPKELLPSEELA
EQVLSYARDLEMIV*

RE36854.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:02:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23919-PA 264 GF23919-PA 1..264 1..264 1222 94.3 Plus
Dana\GF10751-PA 262 GF10751-PA 3..262 6..264 669 50.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:02:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13563-PA 264 GG13563-PA 1..264 1..264 1366 98.1 Plus
Dere\GG13696-PA 262 GG13696-PA 1..262 4..264 666 50 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:02:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15898-PA 264 GH15898-PA 1..264 1..264 1184 89.8 Plus
Dgri\GH16677-PA 264 GH16677-PA 6..264 9..264 667 48.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:35
Subject Length Description Subject Range Query Range Score Percent Strand
Rpn12-PA 264 CG4157-PA 1..264 1..264 1328 100 Plus
Rpn12R-PA 262 CG11552-PA 1..262 4..264 660 49.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:02:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16550-PA 264 GI16550-PA 1..264 1..264 1169 88.6 Plus
Dmoj\GI11363-PA 264 GI11363-PA 1..264 4..264 660 47.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:02:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17868-PA 264 GL17868-PA 1..264 1..264 1156 88.3 Plus
Dper\GL22312-PA 263 GL22312-PA 1..263 4..264 672 47.9 Plus
Dper\GL21520-PA 789 GL21520-PA 1..176 4..178 481 50.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:02:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17993-PA 264 GA17993-PA 1..264 1..264 1156 88.3 Plus
Dpse\GA27448-PA 263 GA27448-PA 1..263 4..264 674 47.9 Plus
Dpse\GA26312-PA 263 GA26312-PA 1..263 4..264 671 48.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:02:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25643-PA 264 GM25643-PA 1..264 1..264 1373 98.9 Plus
Dsec\GM24516-PA 262 GM24516-PA 1..262 4..264 679 50 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:02:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14646-PA 264 GD14646-PA 1..264 1..264 1377 99.2 Plus
Dsim\GD12587-PA 262 GD12587-PA 1..262 4..264 679 50 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:02:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12802-PA 264 GJ12802-PA 1..264 1..264 1188 90.2 Plus
Dvir\GJ11618-PA 264 GJ11618-PA 1..264 4..264 648 49.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:02:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20064-PA 264 GK20064-PA 1..264 1..264 1160 85.6 Plus
Dwil\GK17411-PA 262 GK17411-PA 1..262 4..264 656 48.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:02:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19861-PA 264 GE19861-PA 1..264 1..264 1359 97.3 Plus
Dyak\GE19991-PA 262 GE19991-PA 1..262 4..264 679 49.2 Plus

RE36854.hyp Sequence

Translation from 117 to 911

> RE36854.hyp
MANVESLYKELTAEWSKRPPNTVKCGQLLDQLKVALVKMAFLPTDGNDAQ
SSKKQLILARSVLEVAVEHSVLSKDLLAFERYMAQLKCYYYDYAKIIGES
ESKYKLLGLNLLYLLSGNRVSDFHTELELLSVDVIQHNQFIRPILALEQY
IMEGRYNKIFQAKSTVPVEVYSYFMDLLLETVRDEIGACIEKSYDKISAK
DAAKRLNLRVPDEIKAFGAKRQWKLEASGDYSFTDRSVKPKELLPSEELA
EQVLSYARDLEMIV*

RE36854.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:59:08
Subject Length Description Subject Range Query Range Score Percent Strand
Rpn12-PA 264 CG4157-PA 1..264 1..264 1328 100 Plus
Rpn12R-PA 262 CG11552-PA 1..262 4..264 660 49.6 Plus