Clone RE36972 Report

Search the DGRC for RE36972

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:369
Well:72
Vector:pFlc-1
Associated Gene/TranscriptCG14435-RA
Protein status:RE36972.pep: validated full length
Preliminary Size:3032
Sequenced Size:558

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4557 2002-01-01 Sim4 clustering to Release 2
CG32738 2003-01-01 Sim4 clustering to Release 3
CG32738 2003-01-22 Blastp of sequenced clone

Clone Sequence Records

RE36972.complete Sequence

558 bp (558 high quality bases) assembled on 2003-01-22

GenBank Submission: AY075478

> RE36972.complete
TGGCCAAAAGTGATGGTGCTCGTGGAGTGGATGGGGGGCGGGGGTGGGAG
TAGGTGGCAAGGACGGGGGGCGGGCGTCAATCGGTGCGTAGTTGAGTCGC
GATTGTTATTGTTGCTGCCCCGTTTTCTTGTCCTCCGCCTGCTGATTCCG
GGGACTCAGATGTTTCAGATGTTTCAGATGCTCAGGTGTTCAGTTGCTCT
GGTTCTCCGGTATATTTGGAACTCGAGTCGGCTCTGCGGTCGCCGGATGA
TGACTCCCGATGACAACCGATGACTGATGGATGATGGGCACTAGCTGCTC
CTGCGCCTGCTACTACTTGCTACTTGCCACTTGCAACGGGCTCCTGCTGC
CTAATCCTATGGAATCGGATCCAAACGCTACGCGGTGCACTACTGCTGCT
CTCGCCGACTAAAAAATAGGTGTGACGCGACACGACGCTGCTGGCCAATC
TGCCTTGATTACACTCTCAATTTAAATGACCGTTTTCCATATTTTTTTTT
AATTTTTTTTTATACATTACATTAAAAGAGTTTCTCGATACCAAAAAAAA
AAAAAAAA

RE36972.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:44:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG14435-RA 2774 CG14435-RA 48..589 544..3 2695 99.8 Minus
CG14435-RB 3625 CG14435-RB 23..564 544..3 2695 99.8 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:09:12
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 6735539..6736086 3..540 2490 97.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:52:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:09:10
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 6843357..6843898 3..544 2695 99.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:24:26
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 6851455..6851996 3..544 2695 99.8 Plus
Blast to na_te.dros performed on 2019-03-16 19:09:10 has no hits.

RE36972.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:09:50 Download gff for RE36972.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 6735536..6736088 1..542 97   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:15:44 Download gff for RE36972.complete
Subject Subject Range Query Range Percent Splice Strand
CG5214-RA 487..504 294..311 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:43:21 Download gff for RE36972.complete
Subject Subject Range Query Range Percent Splice Strand
CG14435-RA 25..565 1..542 99   Minus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:32:16 Download gff for RE36972.complete
Subject Subject Range Query Range Percent Splice Strand
CG14435-RB 25..565 1..542 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:23:50 Download gff for RE36972.complete
Subject Subject Range Query Range Percent Splice Strand
CG14435-RA 26..566 1..542 99   Minus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:15:44 Download gff for RE36972.complete
Subject Subject Range Query Range Percent Splice Strand
CG14435-RA 1..309 1..310 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:01:51 Download gff for RE36972.complete
Subject Subject Range Query Range Percent Splice Strand
CG14435-RA 26..566 1..542 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:09:50 Download gff for RE36972.complete
Subject Subject Range Query Range Percent Splice Strand
X 6843354..6843896 1..542 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:09:50 Download gff for RE36972.complete
Subject Subject Range Query Range Percent Splice Strand
X 6843354..6843896 1..542 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:09:50 Download gff for RE36972.complete
Subject Subject Range Query Range Percent Splice Strand
X 6843354..6843896 1..542 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:23:50 Download gff for RE36972.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 6737387..6737929 1..542 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:23:50 Download gff for RE36972.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 6737387..6737929 1..542 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:36:31 Download gff for RE36972.complete
Subject Subject Range Query Range Percent Splice Strand
X 6851452..6851994 1..542 99   Plus

RE36972.hyp Sequence

Translation from 0 to 272

> RE36972.hyp
VPKVMVLVEWMGGGGGSRWQGRGAGVNRCVVESRLLLLLPRFLVLRLLIP
GTQMFQMFQMLRCSVALVLRYIWNSSRLCGRRMMTPDDNR*
Sequence RE36972.hyp has no blast hits.

RE36972.pep Sequence

Translation from 12 to 272

> RE36972.pep
MVLVEWMGGGGGSRWQGRGAGVNRCVVESRLLLLLPRFLVLRLLIPGTQM
FQMFQMLRCSVALVLRYIWNSSRLCGRRMMTPDDNR*
Sequence RE36972.pep has no blast hits.