Clone RE37354 Report

Search the DGRC for RE37354

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:373
Well:54
Vector:pFlc-1
Associated Gene/Transcriptcib-RC
Protein status:RE37354.pep: gold
Sequenced Size:899

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
cib-RC 2010-01-14 Manual selection by Sue Celniker

Clone Sequence Records

RE37354.complete Sequence

899 bp assembled on 2010-04-19

GenBank Submission: BT120351.2

> RE37354.complete
AGTATTAAATTTGTGACGTCAAGAGCTCCGCTTCGCCACCATCGAAGGCC
CAGCTTCGCCAAGTGTACAGCTATACATAGAAACATATATCAGGCCGACC
CCGCCAGCATCCCAGCTTAGTAGTCCGCTTCGCCAATCCAAAAAAAAAAC
TAAATCAAGATGGCCGCCCCAGCACCAGCACTCAAGGATCTGCCCAAGGT
GGCCGAGAACCTGAAAAGCCAGTTGGAGGGATTCAACCAGGACAAACTGA
AGAACGCTAGCACCCAGGAGAAGATCATTCTTCCCACCGCCGAAGATGTG
GCTGCCGAGAAGACCCAACAGTCGATCTTCGAGGGCATCACCGCTTTCAA
TCAGAACAACTTGAAGCACACGGAGACCAACGAGAAGAACCCGTTGCCCG
ATAAGGAAGGAGAAGGAGAAGAATCAGTTCATCGCCGGCATCGAGAACTT
TGATGCGAAAAAGTTGAAGCACACCGAGACCAATGAGAAGAACGTGCTGC
CCACCAAGGAGGTGATCGAGGCCGAGAAGCAGGCTTAAAATGGGGGCTCC
AATGTGGTCCACTCCGATCCGAGATCCGAGATCTGAGATCCGATCCGATC
CGATCCTCAGTCACCCCATCTCTCTTTTTCGACTCGCCGCATCTCACTCT
TTATACGTATAAAGCTATTCCCTCTCATTTTTCAACTGCTACCAAGTTAT
TCGAACCGCTGCGCATGCGCGTGATAGCAAAAGTATTTTACTATTATCGT
ATTTCGGTTGTCCGTTTTTTTTTTTTTTTGCAATATTTTTACACATATAT
ATATATATTTTTTGTATTAACAAGCAAGAGAGCCAGTCTCATTCCTACAG
CGTAATTAACATAAAATAAACATTCGTCTATCCCAAAAAAAAAAAAAAA

RE37354.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:48:01
Subject Length Description Subject Range Query Range Score Percent Strand
cib.e 1339 cib.e 560..1036 408..885 2350 99.7 Plus
cib-RA 1007 cib-RA 527..1003 408..885 2350 99.7 Plus
cib.h 1394 cib.h 527..1003 408..885 2350 99.7 Plus
cib.e 1339 cib.e 1..410 1..410 2050 100 Plus
cib-RA 1007 cib-RA 109..517 1..409 2045 100 Plus
cib.h 1394 cib.h 109..517 1..409 2045 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:31:03
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 4003387..4003861 408..884 2320 99.6 Plus
chrX 22417052 chrX 3999341..3999499 1..159 780 99.4 Plus
chrX 22417052 chrX 4002913..4003050 158..295 690 100 Plus
chrX 22417052 chrX 4003121..4003237 294..410 585 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:53:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:31:01
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4110161..4110637 408..885 2340 99.8 Plus
X 23542271 X 4106115..4106273 1..159 795 100 Plus
X 23542271 X 4109687..4109824 158..295 690 100 Plus
X 23542271 X 4109895..4110011 294..410 585 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:45:09
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 4118259..4118735 408..885 2350 99.7 Plus
X 23527363 X 4114213..4114371 1..159 795 100 Plus
X 23527363 X 4117785..4117922 158..295 690 100 Plus
X 23527363 X 4117993..4118109 294..410 585 100 Plus
Blast to na_te.dros performed 2019-03-16 15:31:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\Newton 1510 Dbuz\Newton NEWTON 1510bp 216..344 612..736 112 59.5 Plus
Dbuz\Newton 1510 Dbuz\Newton NEWTON 1510bp 1168..1296 736..612 112 59.5 Minus

RE37354.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:32:11 Download gff for RE37354.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 4002915..4003050 160..295 100 -> Plus
chrX 4003123..4003236 296..409 100 -> Plus
chrX 3999341..3999499 1..159 99 -> Plus
chrX 4003389..4003861 410..884 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-04-19 15:46:36 Download gff for RE37354.complete
Subject Subject Range Query Range Percent Splice Strand
cib-RC 1..294 160..453 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:30:09 Download gff for RE37354.complete
Subject Subject Range Query Range Percent Splice Strand
cib-RC 1..294 160..453 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:12:48 Download gff for RE37354.complete
Subject Subject Range Query Range Percent Splice Strand
cib-RB 1..390 160..538 97   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:43:45 Download gff for RE37354.complete
Subject Subject Range Query Range Percent Splice Strand
cib-RB 1..390 160..538 97   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-19 15:46:36 Download gff for RE37354.complete
Subject Subject Range Query Range Percent Splice Strand
cib-RC 1..883 1..884 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:30:09 Download gff for RE37354.complete
Subject Subject Range Query Range Percent Splice Strand
cib-RC 1..883 1..884 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:12:48 Download gff for RE37354.complete
Subject Subject Range Query Range Percent Splice Strand
cib-RC 3..885 1..884 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:43:45 Download gff for RE37354.complete
Subject Subject Range Query Range Percent Splice Strand
cib-RC 3..885 1..884 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:32:11 Download gff for RE37354.complete
Subject Subject Range Query Range Percent Splice Strand
X 4109897..4110010 296..409 100 -> Plus
X 4106115..4106273 1..159 100 -> Plus
X 4109689..4109824 160..295 100 -> Plus
X 4110163..4110636 410..884 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:32:11 Download gff for RE37354.complete
Subject Subject Range Query Range Percent Splice Strand
X 4109897..4110010 296..409 100 -> Plus
X 4106115..4106273 1..159 100 -> Plus
X 4109689..4109824 160..295 100 -> Plus
X 4110163..4110636 410..884 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:32:11 Download gff for RE37354.complete
Subject Subject Range Query Range Percent Splice Strand
X 4109897..4110010 296..409 100 -> Plus
X 4106115..4106273 1..159 100 -> Plus
X 4109689..4109824 160..295 100 -> Plus
X 4110163..4110636 410..884 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:12:48 Download gff for RE37354.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 4003930..4004043 296..409 100 -> Plus
arm_X 4000148..4000306 1..159 100 -> Plus
arm_X 4003722..4003857 160..295 100 -> Plus
arm_X 4004196..4004669 410..884 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:15:26 Download gff for RE37354.complete
Subject Subject Range Query Range Percent Splice Strand
X 4118261..4118734 410..884 99   Plus
X 4114213..4114371 1..159 100 -> Plus
X 4117787..4117922 160..295 100 -> Plus
X 4117995..4118108 296..409 100 -> Plus

RE37354.pep Sequence

Translation from 159 to 452

> RE37354.pep
MAAPAPALKDLPKVAENLKSQLEGFNQDKLKNASTQEKIILPTAEDVAAE
KTQQSIFEGITAFNQNNLKHTETNEKNPLPDKEGEGEESVHRRHREL*

RE37354.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:25:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20776-PA 130 GF20776-PA 1..85 1..84 390 92.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:25:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18692-PA 129 GG18692-PA 1..84 1..84 422 98.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:25:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24145-PA 129 GH24145-PA 1..84 1..84 396 92.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:58:33
Subject Length Description Subject Range Query Range Score Percent Strand
cib-PC 97 CG4944-PC 1..97 1..97 495 100 Plus
cib-PE 129 CG4944-PE 1..88 1..88 422 95.5 Plus
cib-PD 129 CG4944-PD 1..88 1..88 422 95.5 Plus
cib-PB 129 CG4944-PB 1..88 1..88 422 95.5 Plus
cib-PA 129 CG4944-PA 1..88 1..88 422 95.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:25:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16398-PA 129 GI16398-PA 1..84 1..84 402 94 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:25:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21390-PA 129 GL21390-PA 1..84 1..84 396 92.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:25:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18544-PA 129 GA18544-PA 1..84 1..84 396 92.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:25:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12325-PA 129 GM12325-PA 1..84 1..84 422 98.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:25:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16670-PA 129 GD16670-PA 1..84 1..84 416 97.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:25:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17019-PA 129 GJ17019-PA 1..84 1..84 382 89.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:25:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15570-PA 143 GK15570-PA 15..98 1..84 396 92.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:25:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16331-PA 129 GE16331-PA 1..84 1..84 422 98.8 Plus

RE37354.hyp Sequence

Translation from 159 to 452

> RE37354.hyp
MAAPAPALKDLPKVAENLKSQLEGFNQDKLKNASTQEKIILPTAEDVAAE
KTQQSIFEGITAFNQNNLKHTETNEKNPLPDKEGEGEESVHRRHREL*

RE37354.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:22:27
Subject Length Description Subject Range Query Range Score Percent Strand
cib-PC 97 CG4944-PC 1..97 1..97 495 100 Plus
cib-PE 129 CG4944-PE 1..88 1..88 422 95.5 Plus
cib-PD 129 CG4944-PD 1..88 1..88 422 95.5 Plus
cib-PB 129 CG4944-PB 1..88 1..88 422 95.5 Plus
cib-PA 129 CG4944-PA 1..88 1..88 422 95.5 Plus