BDGP Sequence Production Resources |
Search the DGRC for RE37829
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 378 |
Well: | 29 |
Vector: | pFlc-1 |
Associated Gene/Transcript | RpL8-RA |
Protein status: | RE37829.pep: gold |
Sequenced Size: | 1019 |
Gene | Date | Evidence |
---|---|---|
CG1263 | 2001-12-14 | Blastp of sequenced clone |
CG1263 | 2002-01-01 | Sim4 clustering to Release 2 |
CG1263 | 2003-01-01 | Sim4 clustering to Release 3 |
RpL8 | 2008-04-29 | Release 5.5 accounting |
RpL8 | 2008-08-15 | Release 5.9 accounting |
RpL8 | 2008-12-18 | 5.12 accounting |
1019 bp (1019 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071342
> RE37829.complete CTTTTTTCTTTTCTTTTCGCCCCGTTTCCGGAGTGGTCGTATTGGGCAAT TTTAATTTTACGCAATGGGTCGCGTTATTCGTGCACAGCGTAAGGGAGCT GGTTCCGTGTTCAAGGCGCACGTGAAGAAGCGCAAGGGAGCCGCCAAGCT GCGTTCCCTGGACTTCGCCGAGCGTTCCGGCTACATCCGCGGAGTTGTCA AGGACATCATCCACGATCCCGGCCGTGGCGCTCCTCTGGCCGTCGTCCAC TTCCGCGACCCCTACCGCTACAAGATCCGCAAGGAGCTGTTCATCGCCCC CGAGGGCATGCACACCGGCCAGTTCGTGTACTGCGGCCGCAAGGCCACCC TTCAGATCGGCAACGTGATGCCCCTCAGCCAGATGCCCGAGGGTACCATC ATCTGCAACCTGGAGGAGAAGACCGGTGATCGCGGCCGTTTGGCCCGCAC CTCTGGCAACTACGCCACCGTGATTGCCCACAACCAGGACACCAAGAAGA CGCGTGTCAAGCTGCCATCCGGCGCCAAGAAGGTCGTGCCCTCGGCCAAC CGCGCCATGGTTGGCATCGTCGCCGGCGGCGGTCGTATCGACAAGCCCAT CCTGAAGGCCGGTCGTGCCTACCACAAGTACAAGGTGAAGCGCAACAGCT GGCCTAAGGTGCGTGGTGTGGCCATGAACCCCGTGGAGCATCCTCACGGT GGTGGTAACCATCAGCACATTGGTAAGGCCTCCACCGTCAAGCGAGGCAC ATCCGCCGGTCGCAAGGTCGGTCTCATCGCTGCCCGTCGTACCGGTAGGA TCCGTGGTGGCAAGGGCGACAGCAAGGACAAGTAAGCTCTGGCTGCAGCA GGATTCCGGCGTGGCGCAGGTTCCGCCTGAGATCTGGGTAGTGGTCGTGC TCTGCTGTGCGGCGTCGTGGAAGAAATTGCTATTCTACATGGATAATCTG TATGTTCTAGGCATACGCTTGACACGGCAGAATAAAACGTATTTGTAAAA CTACAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL8-RA | 1281 | RpL8-RA | 118..1117 | 4..1003 | 5000 | 100 | Plus |
RpL8.a | 1138 | RpL8.a | 84..1025 | 62..1003 | 4710 | 100 | Plus |
RpL8-RB | 1264 | RpL8-RB | 210..1151 | 62..1003 | 4710 | 100 | Plus |
RpL8.a | 1138 | RpL8.a | 1..51 | 12..62 | 255 | 100 | Plus |
RpL8-RB | 1264 | RpL8-RB | 1..35 | 28..62 | 175 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 2587592..2588394 | 201..1003 | 4015 | 100 | Plus |
chr3L | 24539361 | chr3L | 2587260..2587401 | 62..203 | 710 | 100 | Plus |
chr3L | 24539361 | chr3L | 2586965..2587023 | 4..62 | 295 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 2586962..2587023 | 1..62 | 98 | -> | Plus |
chr3L | 2587261..2587400 | 63..202 | 100 | -> | Plus |
chr3L | 2587594..2588394 | 203..1004 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL8-RB | 1..771 | 65..835 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL8-RB | 1..771 | 65..835 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL8-RA | 1..771 | 65..835 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL8-RB | 1..771 | 65..835 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL8-RA | 1..771 | 65..835 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL8-RA | 3..1005 | 1..1004 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL8-RA | 3..1005 | 1..1004 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL8-RA | 1..998 | 5..1002 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL8-RA | 3..1005 | 1..1004 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL8-RA | 1..998 | 5..1002 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 2587751..2587890 | 63..202 | 100 | -> | Plus |
3L | 2587452..2587513 | 1..62 | 98 | -> | Plus |
3L | 2588084..2588884 | 203..1004 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 2587751..2587890 | 63..202 | 100 | -> | Plus |
3L | 2587452..2587513 | 1..62 | 98 | -> | Plus |
3L | 2588084..2588884 | 203..1004 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 2587751..2587890 | 63..202 | 100 | -> | Plus |
3L | 2587452..2587513 | 1..62 | 98 | -> | Plus |
3L | 2588084..2588884 | 203..1004 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 2587452..2587513 | 1..62 | 98 | -> | Plus |
arm_3L | 2587751..2587890 | 63..202 | 100 | -> | Plus |
arm_3L | 2588084..2588884 | 203..1004 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 2588084..2588884 | 203..1004 | 99 | Plus | |
3L | 2587452..2587513 | 1..62 | 98 | -> | Plus |
3L | 2587751..2587890 | 63..202 | 100 | -> | Plus |
Translation from 64 to 834
> RE37829.pep MGRVIRAQRKGAGSVFKAHVKKRKGAAKLRSLDFAERSGYIRGVVKDIIH DPGRGAPLAVVHFRDPYRYKIRKELFIAPEGMHTGQFVYCGRKATLQIGN VMPLSQMPEGTIICNLEEKTGDRGRLARTSGNYATVIAHNQDTKKTRVKL PSGAKKVVPSANRAMVGIVAGGGRIDKPILKAGRAYHKYKVKRNSWPKVR GVAMNPVEHPHGGGNHQHIGKASTVKRGTSAGRKVGLIAARRTGRIRGGK GDSKDK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24234-PA | 246 | GF24234-PA | 8..246 | 18..256 | 1234 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14870-PA | 256 | GG14870-PA | 1..256 | 1..256 | 1326 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16390-PA | 256 | GH16390-PA | 1..256 | 1..256 | 1321 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL8-PB | 256 | CG1263-PB | 1..256 | 1..256 | 1335 | 100 | Plus |
RpL8-PA | 256 | CG1263-PA | 1..256 | 1..256 | 1335 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12472-PA | 256 | GI12472-PA | 1..256 | 1..256 | 1314 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL22453-PA | 150 | GL22453-PA | 1..150 | 107..256 | 759 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11728-PA | 256 | GA11728-PA | 1..256 | 1..256 | 1315 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14495-PA | 256 | GM14495-PA | 1..256 | 1..256 | 1326 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD13692-PA | 256 | GD13692-PA | 1..256 | 1..256 | 1321 | 99.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12374-PA | 256 | GJ12374-PA | 1..256 | 1..256 | 1314 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK12506-PA | 256 | GK12506-PA | 1..256 | 1..256 | 1312 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE20324-PA | 256 | GE20324-PA | 1..256 | 1..256 | 1326 | 100 | Plus |
Translation from 64 to 834
> RE37829.hyp MGRVIRAQRKGAGSVFKAHVKKRKGAAKLRSLDFAERSGYIRGVVKDIIH DPGRGAPLAVVHFRDPYRYKIRKELFIAPEGMHTGQFVYCGRKATLQIGN VMPLSQMPEGTIICNLEEKTGDRGRLARTSGNYATVIAHNQDTKKTRVKL PSGAKKVVPSANRAMVGIVAGGGRIDKPILKAGRAYHKYKVKRNSWPKVR GVAMNPVEHPHGGGNHQHIGKASTVKRGTSAGRKVGLIAARRTGRIRGGK GDSKDK*