Clone RE37829 Report

Search the DGRC for RE37829

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:378
Well:29
Vector:pFlc-1
Associated Gene/TranscriptRpL8-RA
Protein status:RE37829.pep: gold
Sequenced Size:1019

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1263 2001-12-14 Blastp of sequenced clone
CG1263 2002-01-01 Sim4 clustering to Release 2
CG1263 2003-01-01 Sim4 clustering to Release 3
RpL8 2008-04-29 Release 5.5 accounting
RpL8 2008-08-15 Release 5.9 accounting
RpL8 2008-12-18 5.12 accounting

Clone Sequence Records

RE37829.complete Sequence

1019 bp (1019 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071342

> RE37829.complete
CTTTTTTCTTTTCTTTTCGCCCCGTTTCCGGAGTGGTCGTATTGGGCAAT
TTTAATTTTACGCAATGGGTCGCGTTATTCGTGCACAGCGTAAGGGAGCT
GGTTCCGTGTTCAAGGCGCACGTGAAGAAGCGCAAGGGAGCCGCCAAGCT
GCGTTCCCTGGACTTCGCCGAGCGTTCCGGCTACATCCGCGGAGTTGTCA
AGGACATCATCCACGATCCCGGCCGTGGCGCTCCTCTGGCCGTCGTCCAC
TTCCGCGACCCCTACCGCTACAAGATCCGCAAGGAGCTGTTCATCGCCCC
CGAGGGCATGCACACCGGCCAGTTCGTGTACTGCGGCCGCAAGGCCACCC
TTCAGATCGGCAACGTGATGCCCCTCAGCCAGATGCCCGAGGGTACCATC
ATCTGCAACCTGGAGGAGAAGACCGGTGATCGCGGCCGTTTGGCCCGCAC
CTCTGGCAACTACGCCACCGTGATTGCCCACAACCAGGACACCAAGAAGA
CGCGTGTCAAGCTGCCATCCGGCGCCAAGAAGGTCGTGCCCTCGGCCAAC
CGCGCCATGGTTGGCATCGTCGCCGGCGGCGGTCGTATCGACAAGCCCAT
CCTGAAGGCCGGTCGTGCCTACCACAAGTACAAGGTGAAGCGCAACAGCT
GGCCTAAGGTGCGTGGTGTGGCCATGAACCCCGTGGAGCATCCTCACGGT
GGTGGTAACCATCAGCACATTGGTAAGGCCTCCACCGTCAAGCGAGGCAC
ATCCGCCGGTCGCAAGGTCGGTCTCATCGCTGCCCGTCGTACCGGTAGGA
TCCGTGGTGGCAAGGGCGACAGCAAGGACAAGTAAGCTCTGGCTGCAGCA
GGATTCCGGCGTGGCGCAGGTTCCGCCTGAGATCTGGGTAGTGGTCGTGC
TCTGCTGTGCGGCGTCGTGGAAGAAATTGCTATTCTACATGGATAATCTG
TATGTTCTAGGCATACGCTTGACACGGCAGAATAAAACGTATTTGTAAAA
CTACAAAAAAAAAAAAAAA

RE37829.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:42:53
Subject Length Description Subject Range Query Range Score Percent Strand
RpL8-RA 1281 RpL8-RA 118..1117 4..1003 5000 100 Plus
RpL8.a 1138 RpL8.a 84..1025 62..1003 4710 100 Plus
RpL8-RB 1264 RpL8-RB 210..1151 62..1003 4710 100 Plus
RpL8.a 1138 RpL8.a 1..51 12..62 255 100 Plus
RpL8-RB 1264 RpL8-RB 1..35 28..62 175 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:18:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 2587592..2588394 201..1003 4015 100 Plus
chr3L 24539361 chr3L 2587260..2587401 62..203 710 100 Plus
chr3L 24539361 chr3L 2586965..2587023 4..62 295 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:53:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:18:06
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2588082..2588884 201..1003 4015 100 Plus
3L 28110227 3L 2587750..2587891 62..203 710 100 Plus
3L 28110227 3L 2587455..2587513 4..62 295 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:09:48
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 2588082..2588884 201..1003 4015 100 Plus
3L 28103327 3L 2587750..2587891 62..203 710 100 Plus
3L 28103327 3L 2587455..2587513 4..62 295 100 Plus
Blast to na_te.dros performed on 2019-03-16 12:18:06 has no hits.

RE37829.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:19:02 Download gff for RE37829.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 2586962..2587023 1..62 98 -> Plus
chr3L 2587261..2587400 63..202 100 -> Plus
chr3L 2587594..2588394 203..1004 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:13:30 Download gff for RE37829.complete
Subject Subject Range Query Range Percent Splice Strand
RpL8-RB 1..771 65..835 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:08:48 Download gff for RE37829.complete
Subject Subject Range Query Range Percent Splice Strand
RpL8-RB 1..771 65..835 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:07:19 Download gff for RE37829.complete
Subject Subject Range Query Range Percent Splice Strand
RpL8-RA 1..771 65..835 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:33:05 Download gff for RE37829.complete
Subject Subject Range Query Range Percent Splice Strand
RpL8-RB 1..771 65..835 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:42:22 Download gff for RE37829.complete
Subject Subject Range Query Range Percent Splice Strand
RpL8-RA 1..771 65..835 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:37:57 Download gff for RE37829.complete
Subject Subject Range Query Range Percent Splice Strand
RpL8-RA 3..1005 1..1004 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:08:48 Download gff for RE37829.complete
Subject Subject Range Query Range Percent Splice Strand
RpL8-RA 3..1005 1..1004 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:07:19 Download gff for RE37829.complete
Subject Subject Range Query Range Percent Splice Strand
RpL8-RA 1..998 5..1002 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:33:05 Download gff for RE37829.complete
Subject Subject Range Query Range Percent Splice Strand
RpL8-RA 3..1005 1..1004 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:42:22 Download gff for RE37829.complete
Subject Subject Range Query Range Percent Splice Strand
RpL8-RA 1..998 5..1002 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:19:02 Download gff for RE37829.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2587751..2587890 63..202 100 -> Plus
3L 2587452..2587513 1..62 98 -> Plus
3L 2588084..2588884 203..1004 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:19:02 Download gff for RE37829.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2587751..2587890 63..202 100 -> Plus
3L 2587452..2587513 1..62 98 -> Plus
3L 2588084..2588884 203..1004 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:19:02 Download gff for RE37829.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2587751..2587890 63..202 100 -> Plus
3L 2587452..2587513 1..62 98 -> Plus
3L 2588084..2588884 203..1004 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:07:19 Download gff for RE37829.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2587452..2587513 1..62 98 -> Plus
arm_3L 2587751..2587890 63..202 100 -> Plus
arm_3L 2588084..2588884 203..1004 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:10:03 Download gff for RE37829.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2588084..2588884 203..1004 99   Plus
3L 2587452..2587513 1..62 98 -> Plus
3L 2587751..2587890 63..202 100 -> Plus

RE37829.pep Sequence

Translation from 64 to 834

> RE37829.pep
MGRVIRAQRKGAGSVFKAHVKKRKGAAKLRSLDFAERSGYIRGVVKDIIH
DPGRGAPLAVVHFRDPYRYKIRKELFIAPEGMHTGQFVYCGRKATLQIGN
VMPLSQMPEGTIICNLEEKTGDRGRLARTSGNYATVIAHNQDTKKTRVKL
PSGAKKVVPSANRAMVGIVAGGGRIDKPILKAGRAYHKYKVKRNSWPKVR
GVAMNPVEHPHGGGNHQHIGKASTVKRGTSAGRKVGLIAARRTGRIRGGK
GDSKDK*

RE37829.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:05:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24234-PA 246 GF24234-PA 8..246 18..256 1234 99.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:05:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14870-PA 256 GG14870-PA 1..256 1..256 1326 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:05:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16390-PA 256 GH16390-PA 1..256 1..256 1321 99.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:58
Subject Length Description Subject Range Query Range Score Percent Strand
RpL8-PB 256 CG1263-PB 1..256 1..256 1335 100 Plus
RpL8-PA 256 CG1263-PA 1..256 1..256 1335 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:05:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12472-PA 256 GI12472-PA 1..256 1..256 1314 98.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:05:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22453-PA 150 GL22453-PA 1..150 107..256 759 99.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:05:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11728-PA 256 GA11728-PA 1..256 1..256 1315 99.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:05:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14495-PA 256 GM14495-PA 1..256 1..256 1326 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:05:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13692-PA 256 GD13692-PA 1..256 1..256 1321 99.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:05:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12374-PA 256 GJ12374-PA 1..256 1..256 1314 98.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:05:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12506-PA 256 GK12506-PA 1..256 1..256 1312 98.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:05:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20324-PA 256 GE20324-PA 1..256 1..256 1326 100 Plus

RE37829.hyp Sequence

Translation from 64 to 834

> RE37829.hyp
MGRVIRAQRKGAGSVFKAHVKKRKGAAKLRSLDFAERSGYIRGVVKDIIH
DPGRGAPLAVVHFRDPYRYKIRKELFIAPEGMHTGQFVYCGRKATLQIGN
VMPLSQMPEGTIICNLEEKTGDRGRLARTSGNYATVIAHNQDTKKTRVKL
PSGAKKVVPSANRAMVGIVAGGGRIDKPILKAGRAYHKYKVKRNSWPKVR
GVAMNPVEHPHGGGNHQHIGKASTVKRGTSAGRKVGLIAARRTGRIRGGK
GDSKDK*

RE37829.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:04:42
Subject Length Description Subject Range Query Range Score Percent Strand
RpL8-PB 256 CG1263-PB 1..256 1..256 1335 100 Plus
RpL8-PA 256 CG1263-PA 1..256 1..256 1335 100 Plus