Clone RE37955 Report

Search the DGRC for RE37955

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:379
Well:55
Vector:pFlc-1
Associated Gene/TranscriptCpr31A-RA
Protein status:RE37955.pep: gold
Sequenced Size:1240

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG33302 2004-01-14 Blastp of sequenced clone
Cpr31A 2008-04-29 Release 5.5 accounting
Cpr31A 2008-08-15 Release 5.9 accounting
Cpr31A 2008-12-18 5.12 accounting

Clone Sequence Records

RE37955.complete Sequence

1240 bp (1240 high quality bases) assembled on 2004-01-14

GenBank Submission: BT011451

> RE37955.complete
ATCATTAAGTCGACGTCTCTGCCAGAGTCGGACGGATATATACAGTCGTC
AGTCTGAAAGTCATCGCAACCTGTGCGGCACGTGCCACTTCATCCTCGAG
CAAACCGAGTAGTCCAGTGCAAAGGAAGTGATTCCACAATGGCAGGCAAA
CTCCTGACTGTTTTCTCCCTTCTGGCCATCGCCGCATCCTGTCGCGCAGG
ATTCGCCGCCACCTATGCCGGCTATCATCCCGCCTATGCCACCTACCAGG
CACCGGCTGCCGTCTACCATGCGGCACCAGTGGCCCAGGCTGCTGTCTAC
CAGCAGGCGGCTCCAGTTTACGCCAAGACCTTTGTGCCAGCTGCTCCTGT
ATACACCAGATCCTATGCCCTGCCCACTCCAGTTGTCAAGGCGGTGGCTC
CTGCTCCTCTCGCTCTGCCCGTTGCTGCGCCGGTGGTGAAGACCCTGGCT
GCTGCTCCCGTGGTCGCTGCTCCAGTGGTCAAGACTGTGGCTGCTGCTCC
CGCTGTACTGAAACAGGTAGAGTTGGAATCTTCGCCGCGCTACGACTTCT
CCTACGGCGTTCACGACAGCATCACCGGCGATATCAAAAGCCAGGTGGAG
ACCCGTGACGGTGGCAATGTTGTGGGATCCTATTCCGTCCTGGATGCCGA
TGGTTTCAAGCGCACAGTGACCTACACCGCCGACGACATCAACGGATTCA
ATGCGGTGGTCCAGCGGGAACCGGTTGTCGCTGCCCGCGCAGTTGCTGCT
CCAGTGGTTTCCGTCTCCGCTCCAGCTCCAGTTCCCGTCCATATTTCCTC
CGCTCCCGTTGCCTCGCTGCCCGCTCCCATCTACTATCCACACCAGCAGG
TGTTCGCCCCACAGCAGATTCAACAGGTTGCCGAGCAGCAGGGTGAGGTG
GTGGAGTCTCCTGTGGCCCAACAGCCCGAGCTGGAACCCACTCCCATTGA
CTACAACGAGGGTCAGCAGCAGCAGCAGGAGCAGCAGCAGCAGACCTATC
CCCAGGATCAGCAGTTCCCACCCTACTCGCCAGCTGGTCAATCCTCCCCA
GCTCCTGACAGCGATGATTCCGACGTGGTGGAGGCACGATCTGCCCCGGA
GGCCAGCAGCACCACCACCACCGCTGCTCCAGTTACGGAGGAGAACAAGA
AGACGGCCTAGATTGGATTATGAACGGAAATATTGTTGAAATTAATAAGG
AAATGAATAAAATACTTCGAGAACAAAAAAAAAAAAAAAA

RE37955.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:52:02
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr31A-RA 1502 Cpr31A-RA 219..1452 1..1234 6110 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:11:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10053792..10054873 151..1223 5165 98.7 Plus
chr2L 23010047 chr2L 10053148..10053297 1..150 705 98 Plus
chr3R 27901430 chr3R 2517037..2517124 733..646 185 80.7 Minus
chr3L 24539361 chr3L 4210441..4210543 726..624 185 78.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:53:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:11:51
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10054862..10055945 151..1234 5360 99.6 Plus
2L 23513712 2L 10054218..10054367 1..150 750 100 Plus
3R 32079331 3R 6691243..6691330 733..646 185 80.7 Minus
3L 28110227 3L 4211055..4211157 726..624 185 78.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:11:34
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10054862..10055945 151..1234 5360 99.6 Plus
2L 23513712 2L 10054218..10054367 1..150 750 100 Plus
Blast to na_te.dros performed 2019-03-16 19:11:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2759..2854 500..402 135 65 Minus

RE37955.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:13:04 Download gff for RE37955.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10053148..10053297 1..150 98 -> Plus
chr2L 10053792..10054873 151..1224 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:13:38 Download gff for RE37955.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr31A-RA 1..1023 139..1161 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:48:19 Download gff for RE37955.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr31A-RA 1..1023 139..1161 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:24:09 Download gff for RE37955.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr31A-RA 1..1023 139..1161 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:30:09 Download gff for RE37955.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr31A-RA 1..1023 139..1161 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:02:11 Download gff for RE37955.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr31A-RA 1..1023 139..1161 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:58:10 Download gff for RE37955.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr31A-RA 4..1226 1..1224 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:48:19 Download gff for RE37955.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr31A-RA 4..1226 1..1224 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:24:09 Download gff for RE37955.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr31A-RA 6..1228 1..1224 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:30:09 Download gff for RE37955.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr31A-RA 4..1226 1..1224 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:02:11 Download gff for RE37955.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr31A-RA 6..1228 1..1224 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:13:04 Download gff for RE37955.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10054218..10054367 1..150 100 -> Plus
2L 10054862..10055934 151..1224 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:13:04 Download gff for RE37955.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10054218..10054367 1..150 100 -> Plus
2L 10054862..10055934 151..1224 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:13:04 Download gff for RE37955.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10054218..10054367 1..150 100 -> Plus
2L 10054862..10055934 151..1224 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:24:09 Download gff for RE37955.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10054218..10054367 1..150 100 -> Plus
arm_2L 10054862..10055934 151..1224 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:07:08 Download gff for RE37955.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10054862..10055934 151..1224 99   Plus
2L 10054218..10054367 1..150 100 -> Plus

RE37955.pep Sequence

Translation from 138 to 1160

> RE37955.pep
MAGKLLTVFSLLAIAASCRAGFAATYAGYHPAYATYQAPAAVYHAAPVAQ
AAVYQQAAPVYAKTFVPAAPVYTRSYALPTPVVKAVAPAPLALPVAAPVV
KTLAAAPVVAAPVVKTVAAAPAVLKQVELESSPRYDFSYGVHDSITGDIK
SQVETRDGGNVVGSYSVLDADGFKRTVTYTADDINGFNAVVQREPVVAAR
AVAAPVVSVSAPAPVPVHISSAPVASLPAPIYYPHQQVFAPQQIQQVAEQ
QGEVVESPVAQQPELEPTPIDYNEGQQQQQEQQQQTYPQDQQFPPYSPAG
QSSPAPDSDDSDVVEARSAPEASSTTTTAAPVTEENKKTA*

RE37955.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:45:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15740-PA 356 GF15740-PA 1..356 1..340 934 70 Plus
Dana\GF21210-PA 141 GF21210-PA 31..132 103..203 271 57.8 Plus
Dana\GF17801-PA 217 GF17801-PA 38..127 125..212 269 60.4 Plus
Dana\GF17800-PA 223 GF17800-PA 60..147 132..216 269 60.2 Plus
Dana\GF17184-PA 186 GF17184-PA 31..110 129..208 264 61.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:45:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10082-PA 338 GG10082-PA 1..338 1..340 1609 95.6 Plus
Dere\GG10302-PA 211 GG10302-PA 1..112 95..196 258 50.9 Plus
Dere\GG10280-PA 230 GG10280-PA 55..123 128..196 253 66.7 Plus
Dere\GG10291-PA 215 GG10291-PA 62..136 132..204 252 61.3 Plus
Dere\GG14206-PA 148 GG14206-PA 61..142 126..206 249 64.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:45:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11071-PA 352 GH11071-PA 1..346 1..338 656 57.8 Plus
Dgri\GH19486-PA 214 GH19486-PA 65..162 132..233 259 53.3 Plus
Dgri\GH18129-PA 227 GH18129-PA 55..124 133..202 257 65.7 Plus
Dgri\GH19488-PA 195 GH19488-PA 36..136 125..225 254 54.8 Plus
Dgri\GH19487-PA 201 GH19487-PA 68..137 128..197 253 65.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:26
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr31A-PA 340 CG33302-PA 1..340 1..340 1718 100 Plus
Cpr64Ad-PB 247 CG1259-PB 4..247 6..226 339 42.2 Plus
Ccp84Ab-PA 221 CG1252-PA 7..176 76..248 330 47 Plus
Ccp84Aa-PA 205 CG2360-PA 7..176 76..248 324 46.4 Plus
Ccp84Ad-PA 199 CG2341-PA 28..176 96..248 310 47.5 Plus
Ccp84Ae-PA 208 CG1330-PA 1..148 95..231 300 50 Plus
Ccp84Ag-PA 191 CG2342-PA 11..149 104..233 295 48.6 Plus
Cpr30F-PA 146 CG31876-PA 12..146 103..233 289 45.2 Plus
Ccp84Af-PA 151 CG1331-PA 28..148 96..218 271 48.8 Plus
Cpr5C-PA 145 CG4052-PA 28..141 96..211 270 53.8 Plus
Cpr64Ac-PA 188 CG15008-PA 24..184 76..227 268 44.4 Plus
Cpr64Aa-PA 192 CG15006-PA 20..150 86..229 265 49.7 Plus
Cpr92A-PA 245 CG6240-PA 53..161 120..228 265 53.6 Plus
Cpr64Ab-PA 120 CG15007-PA 6..116 100..208 255 53.2 Plus
Ccp84Ac-PA 217 CG1327-PA 63..195 133..287 255 39.4 Plus
Edg84A-PA 188 CG2345-PA 32..126 130..229 251 54 Plus
Cpr23B-PA 302 CG2973-PA 1..235 1..214 242 32.9 Plus
Cpr62Bc-PB 180 CG1919-PB 12..151 100..223 241 46.4 Plus
Cpr62Bc-PA 180 CG1919-PA 12..151 100..223 241 46.4 Plus
Cpr62Bb-PC 194 CG13935-PC 33..179 133..293 230 40.5 Plus
Cpr62Bb-PB 194 CG13935-PB 33..179 133..293 230 40.5 Plus
Cpr62Bb-PA 194 CG13935-PA 33..179 133..293 230 40.5 Plus
CG11584-PB 662 CG11584-PB 229..536 35..333 219 31.5 Plus
Crys-PB 477 CG16963-PB 70..226 128..292 208 31.5 Plus
Crys-PA 477 CG16963-PA 70..226 128..292 208 31.5 Plus
CG34461-PB 138 CG34461-PB 25..137 104..218 204 45.3 Plus
CG34461-PA 138 CG34461-PA 25..137 104..218 204 45.3 Plus
Cpr76Bb-PA 198 CG9290-PA 84..144 133..193 199 63.9 Plus
Cpr66Cb-PA 162 CG7076-PA 79..147 125..193 198 56.5 Plus
CG42367-PC 103 CG42367-PC 31..100 128..196 192 55.7 Plus
Cpr30B-PA 153 CG3818-PA 20..128 127..230 192 39.4 Plus
Cpr35B-PA 218 CG3474-PA 67..131 130..194 190 58.5 Plus
CG11584-PB 662 CG11584-PB 355..572 32..306 188 31.2 Plus
Cpr76Ba-PA 204 CG9283-PA 93..157 128..192 182 55.4 Plus
Cpr76Bc-PD 424 CG9295-PD 45..256 129..331 181 28.4 Plus
Cpr76Bc-PC 424 CG9295-PC 45..256 129..331 181 28.4 Plus
Cpr76Bd-PD 1228 CG9299-PD 1107..1209 87..191 172 45.4 Plus
Cpr76Bd-PB 1228 CG9299-PB 1107..1209 87..191 172 45.4 Plus
Cpr76Bd-PC 1231 CG9299-PC 1110..1212 87..191 172 45.4 Plus
CG13670-PA 266 CG13670-PA 93..159 125..191 162 49.3 Plus
Cpr66D-PA 270 CG32029-PA 153..268 130..246 162 35.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:46:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17588-PA 331 GI17588-PA 1..311 1..326 577 58.4 Plus
Dmoj\GI23757-PA 176 GI23757-PA 59..157 128..233 269 53.8 Plus
Dmoj\GI23842-PA 176 GI23842-PA 59..157 128..233 268 53.8 Plus
Dmoj\GI23758-PA 189 GI23758-PA 36..112 125..198 267 64.9 Plus
Dmoj\GI24313-PA 146 GI24313-PA 5..127 95..215 264 46.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:46:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18957-PA 316 GL18957-PA 1..316 1..340 796 64.8 Plus
Dper\GL22051-PA 217 GL22051-PA 39..118 125..201 273 66.2 Plus
Dper\GL19198-PA 146 GL19198-PA 35..127 123..215 264 53.8 Plus
Dper\GL21772-PA 223 GL21772-PA 34..142 128..233 263 55 Plus
Dper\GL22049-PA 231 GL22049-PA 69..160 133..231 248 51.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:46:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25870-PA 316 GA25870-PA 1..316 1..340 781 64.3 Plus
Dpse\GA12183-PB 217 GA12183-PB 39..118 125..201 273 66.2 Plus
Dpse\GA16543-PA 146 GA16543-PA 35..127 123..215 264 53.8 Plus
Dpse\GA26397-PA 242 GA26397-PA 53..173 128..248 263 51.6 Plus
Dpse\GA12160-PA 231 GA12160-PA 69..160 133..231 248 51.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:46:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17905-PA 339 GM17905-PA 1..339 1..340 1649 98.2 Plus
Dsec\GM10534-PA 208 GM10534-PA 38..127 125..212 268 61.5 Plus
Dsec\GM10531-PA 236 GM10531-PA 55..123 128..196 254 66.7 Plus
Dsec\GM10909-PA 188 GM10909-PA 32..126 130..229 253 52 Plus
Dsec\GM13998-PA 147 GM13998-PA 60..141 126..206 248 64.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:46:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23654-PA 341 GD23654-PA 1..341 1..340 1658 97.7 Plus
Dsim\GD19526-PA 236 GD19526-PA 55..139 128..212 278 64.7 Plus
Dsim\GD13279-PA 147 GD13279-PA 60..141 126..206 248 64.6 Plus
Dsim\GD22323-PA 146 GD22323-PA 33..116 123..206 247 56 Plus
Dsim\GD16755-PA 145 GD16755-PA 42..126 113..197 244 57.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:46:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17932-PA 343 GJ17932-PA 1..337 1..338 685 57.3 Plus
Dvir\GJ23942-PA 183 GJ23942-PA 36..148 125..225 282 58.6 Plus
Dvir\GJ21574-PA 146 GJ21574-PA 21..127 106..215 270 49.1 Plus
Dvir\GJ23301-PA 175 GJ23301-PA 59..145 128..215 267 62.5 Plus
Dvir\GJ23302-PA 256 GJ23302-PA 50..118 128..196 255 65.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:46:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12723-PA 352 GK12723-PA 1..343 1..337 721 57.8 Plus
Dwil\GK18402-PA 354 GK18402-PA 1..345 1..337 656 57.1 Plus
Dwil\GK12249-PA 228 GK12249-PA 42..147 123..230 272 56 Plus
Dwil\GK10832-PA 179 GK10832-PA 53..147 133..230 270 59.2 Plus
Dwil\GK24776-PA 148 GK24776-PA 35..121 123..209 255 55.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:46:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18895-PA 345 GE18895-PA 1..344 1..339 1123 84.2 Plus
Dyak\GE25837-PA 202 GE25837-PA 1..127 95..212 273 50.8 Plus
Dyak\GE16433-PA 154 GE16433-PA 18..132 85..197 265 54.8 Plus
Dyak\GE25835-PA 212 GE25835-PA 21..115 94..196 254 55.8 Plus
Dyak\GE20635-PA 120 GE20635-PA 35..114 128..206 247 66.2 Plus

RE37955.hyp Sequence

Translation from 138 to 1160

> RE37955.hyp
MAGKLLTVFSLLAIAASCRAGFAATYAGYHPAYATYQAPAAVYHAAPVAQ
AAVYQQAAPVYAKTFVPAAPVYTRSYALPTPVVKAVAPAPLALPVAAPVV
KTLAAAPVVAAPVVKTVAAAPAVLKQVELESSPRYDFSYGVHDSITGDIK
SQVETRDGGNVVGSYSVLDADGFKRTVTYTADDINGFNAVVQREPVVAAR
AVAAPVVSVSAPAPVPVHISSAPVASLPAPIYYPHQQVFAPQQIQQVAEQ
QGEVVESPVAQQPELEPTPIDYNEGQQQQQEQQQQTYPQDQQFPPYSPAG
QSSPAPDSDDSDVVEARSAPEASSTTTTAAPVTEENKKTA*

RE37955.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:24:48
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr31A-PA 340 CG33302-PA 1..340 1..340 1718 100 Plus
Cpr64Ad-PB 247 CG1259-PB 4..247 6..226 339 42.2 Plus
Ccp84Ab-PA 221 CG1252-PA 7..176 76..248 330 47 Plus
Ccp84Aa-PA 205 CG2360-PA 7..176 76..248 324 46.4 Plus
Ccp84Ad-PA 199 CG2341-PA 28..176 96..248 310 47.5 Plus