Clone RE38147 Report

Search the DGRC for RE38147

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:381
Well:47
Vector:pFlc-1
Associated Gene/TranscriptCG17029-RA
Protein status:RE38147.pep: gold
Preliminary Size:855
Sequenced Size:1033

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17029 2002-01-01 Sim4 clustering to Release 2
CG17029 2002-06-25 Blastp of sequenced clone
CG17029 2003-01-01 Sim4 clustering to Release 3
CG17029 2008-04-29 Release 5.5 accounting
CG17029 2008-08-15 Release 5.9 accounting
CG17029 2008-12-18 5.12 accounting

Clone Sequence Records

RE38147.complete Sequence

1033 bp (1033 high quality bases) assembled on 2002-06-25

GenBank Submission: AY128476

> RE38147.complete
AGTTCTGCTGCTCAGTCGGAAACCAACAGAAATAGCAATGAGTTCCGCGG
TCAGCGAGTCCAAGCTCAAGGAGTACTACGATGTGGCCCTGAAACTGGTC
CTCAAGTGCGGGCCTCTGATGCAGGAGGGCTATCAGAAGGCAAAGACGGA
ATACAAGGTCAAGGCGGACTTCTACGACCTGGTGACCGTGTACGATAAGC
AAATCGAGGATATTTTGACCGAGGGATTGGTGGCCGCCTTTCCCGAATCC
CTGATCATTGGCGAGGAGGAGTCGGCAGTTTCACAGCGCCAGGCGGAGCT
GACTGATGCACCCACGTGGATCATAGATCCCATCGACGGCACCACAAACT
TCATTCACCGCATCCCGCACTGCTGCATCTCCGTGGGCCTGGCCATCAAC
AAGGAGCTGGTCGTGGGCATTATCTACAATCCACCGGCGAATGAACTATT
CTCCGCCTACAAGGGACACGGAGCCTATCTGAATGGCGAACCCATCCACA
CATCCAAAGTGACGACGATCAAGCAAGCAGTGATTGCCTACGAGATCTCC
CTGATCCACGCCGCCGGAGTGAGGGACAAGAATGTGAAGCGACTGTACAA
GATGGCCTCGAATGCCACGGGAACCAGGTGTTTCGGAAGTGCCGCCCTGA
CCCTGTGCTACGTGGCCACGGGCCAGTGCGATGCCTATCATGTGGAGGAT
CTGAAACCGTGGGACATTGCTGCCGGAGCCATCATTCTGACCGAAGCTGG
CGGCACTGTGTGCCATACCAGCGGATCCAAATTCGATGTGATGAAACCGG
ATTGCGTGTGCGCCGCCACGCCGGAGTTGGCCAAGAATGTGATTAGTCTT
ATCGAAGAGGCCGGTCAGATTACAGAGTACACATTTAAGTAAAGACAGTT
AAAGGCTCAGTATGCAAAGACAGTATCCACATTTATCACTTGTAAACTAT
TCTAATCGCGCAGATATTCCAGTACAATAAAACGACCTAAGTACATATAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

RE38147.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:45:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG17029-RA 1223 CG17029-RA 170..1169 1..1000 5000 100 Plus
CG17028-RA 964 CG17028-RA 269..417 296..444 295 79.8 Plus
CG17028-RA 964 CG17028-RA 546..784 573..811 280 74.4 Plus
CG9391-RA 1124 CG9391-RA 370..464 297..391 190 80 Plus
CG17028-RA 964 CG17028-RA 60..177 87..204 140 74.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:29:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15966843..15967359 1..517 2510 99 Plus
chr3L 24539361 chr3L 15967758..15968239 517..998 2395 99.8 Plus
chr3L 24539361 chr3L 15968605..15968753 296..444 295 79.9 Plus
chr3L 24539361 chr3L 21256405..21256499 391..297 190 80 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:53:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:29:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15977039..15977555 1..517 2585 100 Plus
3L 28110227 3L 15977954..15978437 517..1000 2420 100 Plus
3L 28110227 3L 15978801..15978949 296..444 295 79.9 Plus
3L 28110227 3L 21267397..21267491 391..297 190 80 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:18:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15970139..15970655 1..517 2585 100 Plus
3L 28103327 3L 15971054..15971537 517..1000 2420 100 Plus
3L 28103327 3L 15971901..15972049 296..444 295 79.8 Plus
3L 28103327 3L 21260497..21260591 391..297 190 80 Minus
3L 28103327 3L 15972629..15972757 683..811 165 75.1 Plus
3L 28103327 3L 15968816..15968871 296..351 160 85.7 Plus
3L 28103327 3L 15973728..15973768 296..336 145 90.2 Plus
3L 28103327 3L 15971692..15971809 87..204 140 74.5 Plus
Blast to na_te.dros performed on 2019-03-16 03:29:06 has no hits.

RE38147.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:30:22 Download gff for RE38147.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15966843..15967359 1..517 99 -> Plus
chr3L 15967759..15968239 518..998 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:13:45 Download gff for RE38147.complete
Subject Subject Range Query Range Percent Splice Strand
CG17029-RA 1..855 38..892 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:19:06 Download gff for RE38147.complete
Subject Subject Range Query Range Percent Splice Strand
CG17029-RA 1..855 38..892 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:45:42 Download gff for RE38147.complete
Subject Subject Range Query Range Percent Splice Strand
CG17029-RA 1..855 38..892 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:10:10 Download gff for RE38147.complete
Subject Subject Range Query Range Percent Splice Strand
CG17029-RA 1..855 38..892 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:38:24 Download gff for RE38147.complete
Subject Subject Range Query Range Percent Splice Strand
CG17029-RA 1..855 38..892 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:44:18 Download gff for RE38147.complete
Subject Subject Range Query Range Percent Splice Strand
CG17029-RA 5..1002 1..998 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:19:05 Download gff for RE38147.complete
Subject Subject Range Query Range Percent Splice Strand
CG17029-RA 16..1013 1..998 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:45:42 Download gff for RE38147.complete
Subject Subject Range Query Range Percent Splice Strand
CG17029-RA 7..1004 1..998 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:10:10 Download gff for RE38147.complete
Subject Subject Range Query Range Percent Splice Strand
CG17029-RA 5..1002 1..998 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:38:24 Download gff for RE38147.complete
Subject Subject Range Query Range Percent Splice Strand
CG17029-RA 7..1004 1..998 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:30:22 Download gff for RE38147.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15977039..15977555 1..517 100 -> Plus
3L 15977955..15978435 518..998 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:30:22 Download gff for RE38147.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15977039..15977555 1..517 100 -> Plus
3L 15977955..15978435 518..998 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:30:22 Download gff for RE38147.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15977039..15977555 1..517 100 -> Plus
3L 15977955..15978435 518..998 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:45:42 Download gff for RE38147.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15970139..15970655 1..517 100 -> Plus
arm_3L 15971055..15971535 518..998 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:42:23 Download gff for RE38147.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15970139..15970655 1..517 100 -> Plus
3L 15971055..15971535 518..998 100   Plus

RE38147.hyp Sequence

Translation from 0 to 891

> RE38147.hyp
VLLLSRKPTEIAMSSAVSESKLKEYYDVALKLVLKCGPLMQEGYQKAKTE
YKVKADFYDLVTVYDKQIEDILTEGLVAAFPESLIIGEEESAVSQRQAEL
TDAPTWIIDPIDGTTNFIHRIPHCCISVGLAINKELVVGIIYNPPANELF
SAYKGHGAYLNGEPIHTSKVTTIKQAVIAYEISLIHAAGVRDKNVKRLYK
MASNATGTRCFGSAALTLCYVATGQCDAYHVEDLKPWDIAAGAIILTEAG
GTVCHTSGSKFDVMKPDCVCAATPELAKNVISLIEEAGQITEYTFK*

RE38147.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:43:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG17029-PB 284 CG17029-PB 1..284 13..296 1473 100 Plus
CG17029-PA 284 CG17029-PA 1..284 13..296 1473 100 Plus
CG17028-PB 284 CG17028-PB 1..284 13..296 1054 69.4 Plus
CG17028-PA 284 CG17028-PA 1..284 13..296 1054 69.4 Plus
CG17027-PB 288 CG17027-PB 2..277 15..289 713 46.7 Plus

RE38147.pep Sequence

Translation from 37 to 891

> RE38147.pep
MSSAVSESKLKEYYDVALKLVLKCGPLMQEGYQKAKTEYKVKADFYDLVT
VYDKQIEDILTEGLVAAFPESLIIGEEESAVSQRQAELTDAPTWIIDPID
GTTNFIHRIPHCCISVGLAINKELVVGIIYNPPANELFSAYKGHGAYLNG
EPIHTSKVTTIKQAVIAYEISLIHAAGVRDKNVKRLYKMASNATGTRCFG
SAALTLCYVATGQCDAYHVEDLKPWDIAAGAIILTEAGGTVCHTSGSKFD
VMKPDCVCAATPELAKNVISLIEEAGQITEYTFK*

RE38147.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:54:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24103-PA 284 GF24103-PA 1..284 1..284 1437 93.3 Plus
Dana\GF24104-PA 284 GF24104-PA 1..284 1..284 1006 64.1 Plus
Dana\GF24105-PA 288 GF24105-PA 2..277 3..277 702 46 Plus
Dana\GF24102-PA 286 GF24102-PA 2..277 4..277 676 44.6 Plus
Dana\GF10177-PA 277 GF10177-PA 7..263 10..268 527 41.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:54:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15938-PA 284 GG15938-PA 1..284 1..284 1488 97.9 Plus
Dere\GG15939-PA 288 GG15939-PA 2..277 3..277 713 46.7 Plus
Dere\GG15937-PA 284 GG15937-PA 2..277 4..277 696 46 Plus
Dere\GG13252-PA 278 GG13252-PA 12..264 15..268 532 41.7 Plus
Dere\GG13251-PA 602 GG13251-PA 278..546 6..274 439 37.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:54:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14775-PA 286 GH14775-PA 4..286 2..284 1275 81.3 Plus
Dgri\GH14777-PA 286 GH14777-PA 1..285 1..283 912 60 Plus
Dgri\GH14774-PA 289 GH14774-PA 3..276 6..277 645 43.8 Plus
Dgri\GH14776-PA 290 GH14776-PA 3..278 8..275 638 41.7 Plus
Dgri\GH16522-PA 278 GH16522-PA 7..270 10..274 462 37.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:44:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG17029-PB 284 CG17029-PB 1..284 1..284 1473 100 Plus
CG17029-PA 284 CG17029-PA 1..284 1..284 1473 100 Plus
CG17028-PB 284 CG17028-PB 1..284 1..284 1054 69.4 Plus
CG17028-PA 284 CG17028-PA 1..284 1..284 1054 69.4 Plus
CG17027-PB 288 CG17027-PB 2..277 3..277 713 46.7 Plus
CG17027-PA 288 CG17027-PA 2..277 3..277 713 46.7 Plus
CG17026-PA 284 CG17026-PA 2..277 4..277 675 45.3 Plus
CG9391-PC 278 CG9391-PC 12..270 15..274 515 40.4 Plus
CG9391-PA 278 CG9391-PA 12..270 15..274 515 40.4 Plus
CG9389-PA 596 CG9389-PA 272..540 6..274 435 35.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:54:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11877-PA 283 GI11877-PA 2..283 3..284 1234 79.8 Plus
Dmoj\GI11880-PA 284 GI11880-PA 1..283 1..283 914 58.7 Plus
Dmoj\GI11878-PA 282 GI11878-PA 3..273 8..277 677 44.3 Plus
Dmoj\GI11876-PA 287 GI11876-PA 4..277 6..277 664 43.8 Plus
Dmoj\GI12203-PA 278 GI12203-PA 7..270 10..274 499 38.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:54:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12744-PA 258 GL12744-PA 6..258 5..284 1221 83.2 Plus
Dper\GL12745-PA 286 GL12745-PA 6..286 5..284 1061 70.5 Plus
Dper\GL12746-PA 284 GL12746-PA 15..271 20..275 687 47.1 Plus
Dper\GL12743-PA 287 GL12743-PA 2..277 4..277 654 43.5 Plus
Dper\GL24596-PA 278 GL24596-PA 7..270 10..274 494 37.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:54:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14281-PA 285 GA14281-PA 6..285 5..284 1390 91.8 Plus
Dpse\GA28212-PA 286 GA28212-PA 6..286 5..284 1065 70.8 Plus
Dpse\GA14279-PA 292 GA14279-PA 13..279 10..275 693 45.7 Plus
Dpse\GA14278-PA 287 GA14278-PA 2..277 4..277 655 43.5 Plus
Dpse\GA23361-PA 278 GA23361-PA 7..270 10..274 519 38.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:55:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25568-PA 284 GM25568-PA 1..284 1..284 1492 98.2 Plus
Dsec\GM25569-PA 284 GM25569-PA 1..284 1..284 1072 68.3 Plus
Dsec\GM25570-PA 288 GM25570-PA 2..277 3..277 704 45.7 Plus
Dsec\GM25567-PA 284 GM25567-PA 2..277 4..277 673 44.9 Plus
Dsec\GM22155-PA 592 GM22155-PA 268..527 6..265 434 38.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:55:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14583-PA 284 GD14583-PA 1..284 1..284 1496 98.6 Plus
Dsim\GD14584-PA 284 GD14584-PA 1..284 1..284 1078 68.7 Plus
Dsim\GD14585-PA 288 GD14585-PA 2..277 3..277 713 46 Plus
Dsim\GD14582-PA 284 GD14582-PA 2..277 4..277 676 44.9 Plus
Dsim\GD12132-PA 278 GD12132-PA 1..270 1..274 498 40.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:55:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13573-PA 285 GJ13573-PA 3..285 2..284 1272 82.3 Plus
Dvir\GJ13574-PA 356 GJ13574-PA 3..267 8..271 657 44.2 Plus
Dvir\GJ13572-PA 282 GJ13572-PA 3..272 10..277 650 44.1 Plus
Dvir\GJ11436-PA 278 GJ11436-PA 7..270 10..274 472 38.5 Plus
Dvir\GJ11433-PA 304 GJ11433-PA 31..285 19..274 468 37.1 Plus
Dvir\GJ13574-PA 356 GJ13574-PA 268..355 196..283 281 58 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:55:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24473-PA 281 GK24473-PA 3..281 6..284 1329 87.8 Plus
Dwil\GK24463-PA 284 GK24463-PA 3..277 6..277 670 44.7 Plus
Dwil\GK24484-PA 290 GK24484-PA 4..276 6..277 655 45.1 Plus
Dwil\GK17369-PA 279 GK17369-PA 4..271 6..274 511 38.3 Plus
Dwil\GK20398-PA 704 GK20398-PA 330..588 10..268 481 39.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:55:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22872-PA 284 GE22872-PA 1..284 1..284 1488 98.2 Plus
Dyak\GE22876-PA 284 GE22876-PA 1..284 1..284 1488 98.2 Plus
Dyak\GE22877-PA 283 GE22877-PA 1..283 1..284 1082 70.4 Plus
Dyak\GE22873-PA 284 GE22873-PA 1..284 1..284 1070 69.7 Plus
Dyak\GE22878-PA 288 GE22878-PA 4..277 5..277 715 47.1 Plus