Clone RE38157 Report

Search the DGRC for RE38157

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:381
Well:57
Vector:pFlc-1
Associated Gene/TranscriptRtnl1-RC
Protein status:RE38157.pep: gold
Sequenced Size:1268

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Rtnl1-RC 2009-06-22 Replacement based on scoring

Clone Sequence Records

RE38157.complete Sequence

1268 bp assembled on 2009-08-07

GenBank Submission: BT099515.1

> RE38157.complete
GGAACTTGGCAGCGAACGTCAAACGTAGGAGCACCGCGAACGATCCGTTG
GAAAACCCGAAAACTTGAATACCCGAAAAATGTCGAACAGATTGTTGGAA
TCCCTTATCTACTGGCGCGATGTGAAGAAATCCGGCATTGTCTTCGGCGC
TGGCCTGATCACACTGGCGGCCATCTCCAGCTTCTCGGTGATCAGCGTGT
TCGCCTACTTGTCGCTCCTAACCCTCTTCGGCACCGTCGCCTTCAGAATC
TACAAATCTGTGACACAGGCCGTGCAAAAGACAAACGAGGGTCACCCCTT
TAAGGATTACCTGGAGCTGGATCTGACGCTGTCGCACGAAAAGGTACAGA
ACATTGCCGGCGTGGCTGTGGCACATATCAATGGCTTCATCTCCGAGCTG
AGGCGTCTGTTTCTTGTTGAGGATATCATCGATTCGATCAAGTTCGGCGT
CATTCTGTGGGTCTTCACCTACGTGGGTGCCTGGTTCAATGGCATGACTC
TGGTCATCTTGGCCTTTGTCTCGCTGTTTACCTTGCCCAAGGTCTACGAG
AACAACAAGCAATCGATCGACACTCACTTGGATCTGGTGCGCAGCAAATT
GACAGAAATCACCGACAAGATCCGAGTGGCCATCCCCATTGGCAACAAGA
AGCCCGAGGCCGCTGCCGAGTCTGAGAAGGACAAGTAAAGAACCCGCACT
AGCAAGAGAAACAACCACAAATAAACATGTTTATTTATTTATTAAGCATT
ATTTGAATGGTTTTAATATTCATCCAGGCATTAAATAAATAACAAGTCTA
GCAGCAATGTTTACATATTAATTGTATAATTGCAATCAACATCAATCGAT
AATTGTAAATCAAATTTGAAGAGACCCAAAACAATTTATCAACCAACAAC
TCGTAGCAGTTTCAAACATTGTCCAAGTGTCTTTAAGTTTTTAACGAACG
AAACATTTAAAAAGCATATATAGTGAGGGAAATTAAGAAGAAAACGATTA
TATAGACGCAGCAATGCAAATAAATTTCTTATGAGTTCCACGCAATTTCC
GATTTGAATCAACTATCTTCATTTCGATTTATTCAGCTTTCTTAGTTTTC
ATGTGACCCTTTTTAAATTAATTCTTTGCTTTAGTTTTAGTTTTACTATT
TTGTTGATTTTTTGTATAAAACAACAAGAAGAACTAAGATTACTCTTAAA
AACAAACAAACAAGAAAAAATCAAATAAAAAATGAAGTAAAAATCCACAA
CCAAAAAAAAAAAAAAAA

RE38157.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:29:33
Subject Length Description Subject Range Query Range Score Percent Strand
Rtnl1.h 2043 Rtnl1.h 61..1310 2..1251 6250 100 Plus
Rtnl1-RC 1647 Rtnl1-RC 182..1431 2..1251 6250 100 Plus
Rtnl1.k 3453 Rtnl1.k 1559..2720 90..1251 5795 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:09:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 4992745..4993377 1251..619 3165 100 Minus
chr2L 23010047 chr2L 4993608..4993816 512..304 1045 100 Minus
chr2L 23010047 chr2L 4993886..4994094 304..96 1045 100 Minus
chr2L 23010047 chr2L 4993438..4993545 619..512 540 100 Minus
chr2L 23010047 chr2L 4994476..4994569 95..2 470 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:53:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:09:17
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4993645..4994277 1251..619 3165 100 Minus
2L 23513712 2L 4994508..4994716 512..304 1045 100 Minus
2L 23513712 2L 4994786..4994994 304..96 1045 100 Minus
2L 23513712 2L 4994338..4994445 619..512 540 100 Minus
2L 23513712 2L 4995376..4995469 95..2 470 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:25:15
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4993645..4994277 1251..619 3165 100 Minus
2L 23513712 2L 4994786..4994994 304..96 1045 100 Minus
2L 23513712 2L 4994508..4994716 512..304 1045 100 Minus
2L 23513712 2L 4994338..4994445 619..512 540 100 Minus
2L 23513712 2L 4995376..4995469 95..2 470 100 Minus
Blast to na_te.dros performed 2019-03-15 21:09:18
Subject Length Description Subject Range Query Range Score Percent Strand
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 843..904 791..731 118 67.7 Minus
gypsy5 7369 gypsy5 GYPSY5 7369bp 5753..5844 985..1078 114 62.5 Plus
copia 5143 copia DMCOPIA 5143bp Derived from X02599 (g7740) (Rel. 49, Last updated, Version 4). 5053..5110 687..744 110 65.5 Plus

RE38157.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:10:34 Download gff for RE38157.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 4994476..4994569 1..95 98   Minus
chr2L 4992744..4993377 619..1252 99 <- Minus
chr2L 4993439..4993544 513..618 100 <- Minus
chr2L 4993608..4993816 304..512 100 <- Minus
chr2L 4993887..4994094 96..303 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:13:11 Download gff for RE38157.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl1-RC 1..609 80..688 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:57:06 Download gff for RE38157.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl1-RC 1..609 80..688 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:38:53 Download gff for RE38157.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl1-RC 1..609 80..688 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:44:40 Download gff for RE38157.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl1-RC 1..609 80..688 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-07 08:57:19 Download gff for RE38157.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl1-RC 1..1239 13..1252 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:57:06 Download gff for RE38157.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl1-RC 60..1310 1..1252 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:38:53 Download gff for RE38157.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl1-RC 13..1263 1..1252 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:44:40 Download gff for RE38157.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl1-RC 13..1263 1..1252 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:10:34 Download gff for RE38157.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4993644..4994277 619..1252 99 <- Minus
2L 4994339..4994444 513..618 100 <- Minus
2L 4994508..4994716 304..512 100 <- Minus
2L 4994787..4994994 96..303 100 <- Minus
2L 4995376..4995469 1..95 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:10:34 Download gff for RE38157.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4993644..4994277 619..1252 99 <- Minus
2L 4994339..4994444 513..618 100 <- Minus
2L 4994508..4994716 304..512 100 <- Minus
2L 4994787..4994994 96..303 100 <- Minus
2L 4995376..4995469 1..95 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:10:34 Download gff for RE38157.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4993644..4994277 619..1252 99 <- Minus
2L 4994339..4994444 513..618 100 <- Minus
2L 4994508..4994716 304..512 100 <- Minus
2L 4994787..4994994 96..303 100 <- Minus
2L 4995376..4995469 1..95 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:38:53 Download gff for RE38157.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4994339..4994444 513..618 100 <- Minus
arm_2L 4994508..4994716 304..512 100 <- Minus
arm_2L 4994787..4994994 96..303 100 <- Minus
arm_2L 4995376..4995469 1..95 98   Minus
arm_2L 4993644..4994277 619..1252 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:48:40 Download gff for RE38157.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4993644..4994277 619..1252 99 <- Minus
2L 4994339..4994444 513..618 100 <- Minus
2L 4994508..4994716 304..512 100 <- Minus
2L 4994787..4994994 96..303 100 <- Minus
2L 4995376..4995469 1..95 98   Minus

RE38157.hyp Sequence

Translation from 79 to 687

> RE38157.hyp
MSNRLLESLIYWRDVKKSGIVFGAGLITLAAISSFSVISVFAYLSLLTLF
GTVAFRIYKSVTQAVQKTNEGHPFKDYLELDLTLSHEKVQNIAGVAVAHI
NGFISELRRLFLVEDIIDSIKFGVILWVFTYVGAWFNGMTLVILAFVSLF
TLPKVYENNKQSIDTHLDLVRSKLTEITDKIRVAIPIGNKKPEAAAESEK
DK*

RE38157.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:06:15
Subject Length Description Subject Range Query Range Score Percent Strand
Rtnl1-PC 202 CG33113-PC 1..202 1..202 1008 100 Plus
Rtnl1-PG 224 CG33113-PG 23..224 1..202 985 97.5 Plus
Rtnl1-PD 224 CG33113-PD 23..224 1..202 985 97.5 Plus
Rtnl1-PL 222 CG33113-PL 26..222 6..202 982 99.5 Plus
Rtnl1-PA 222 CG33113-PA 26..222 6..202 981 99.5 Plus

RE38157.pep Sequence

Translation from 79 to 687

> RE38157.pep
MSNRLLESLIYWRDVKKSGIVFGAGLITLAAISSFSVISVFAYLSLLTLF
GTVAFRIYKSVTQAVQKTNEGHPFKDYLELDLTLSHEKVQNIAGVAVAHI
NGFISELRRLFLVEDIIDSIKFGVILWVFTYVGAWFNGMTLVILAFVSLF
TLPKVYENNKQSIDTHLDLVRSKLTEITDKIRVAIPIGNKKPEAAAESEK
DK*

RE38157.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:40:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14162-PA 596 GF14162-PA 401..596 6..202 940 91.4 Plus
Dana\GF17296-PA 259 GF17296-PA 17..185 4..171 253 32.7 Plus
Dana\GF10829-PA 294 GF10829-PA 28..193 4..168 231 35.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:40:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24328-PA 607 GG24328-PA 411..607 6..202 984 95.4 Plus
Dere\GG25105-PA 246 GG25105-PA 3..165 6..167 223 31.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:40:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11424-PA 234 GH11424-PA 38..234 6..202 910 88.3 Plus
Dgri\GH17123-PA 245 GH17123-PA 1..161 5..164 164 32.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:25
Subject Length Description Subject Range Query Range Score Percent Strand
Rtnl1-PC 202 CG33113-PC 1..202 1..202 1008 100 Plus
Rtnl1-PG 224 CG33113-PG 23..224 1..202 985 97.5 Plus
Rtnl1-PD 224 CG33113-PD 23..224 1..202 985 97.5 Plus
Rtnl1-PF 595 CG33113-PF 398..595 5..202 985 99.5 Plus
Rtnl1-PL 222 CG33113-PL 26..222 6..202 982 99.5 Plus
Rtnl1-PA 222 CG33113-PA 26..222 6..202 981 99.5 Plus
Rtnl1-PJ 234 CG33113-PJ 38..234 6..202 981 99.5 Plus
Rtnl1-PI 234 CG33113-PI 38..234 6..202 981 99.5 Plus
Rtnl1-PB 234 CG33113-PB 38..234 6..202 981 99.5 Plus
Rtnl1-PE 234 CG33113-PE 38..234 6..202 981 99.5 Plus
Rtnl1-PH 607 CG33113-PH 411..607 6..202 981 99.5 Plus
Rtnl2-PC 255 CG1279-PC 19..216 6..202 235 32.3 Plus
Rtnl2-PB 255 CG1279-PB 19..216 6..202 235 32.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:40:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14630-PA 234 GI14630-PA 37..234 5..202 952 91.9 Plus
Dmoj\GI11728-PA 258 GI11728-PA 13..175 7..168 260 33.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:40:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26483-PA 571 GL26483-PA 374..571 5..202 969 92.9 Plus
Dper\GL12168-PA 319 GL12168-PA 26..187 6..164 211 30.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:40:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28881-PA 224 GA28881-PA 28..224 6..202 963 93.4 Plus
Dpse\GA11813-PA 298 GA11813-PA 3..164 6..164 213 30.2 Plus
Dpse\GA11813-PB 321 GA11813-PB 26..187 6..164 213 30.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:40:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18049-PA 234 GM18049-PA 38..234 6..202 1005 99 Plus
Dsec\GM10472-PA 238 GM10472-PA 3..205 6..202 217 30.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:40:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22669-PA 234 GD22669-PA 38..234 6..202 1005 99 Plus
Dsim\GD19473-PA 238 GD19473-PA 3..205 6..202 225 30.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:40:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17140-PA 236 GJ17140-PA 38..234 6..202 929 89.8 Plus
Dvir\GJ11400-PA 265 GJ11400-PA 19..208 7..193 286 33.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:40:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24458-PA 587 GK24458-PA 389..585 6..202 948 91.4 Plus
Dwil\GK11074-PA 247 GK11074-PA 16..179 6..168 292 36.6 Plus
Dwil\GK19145-PA 159 GK19145-PA 15..156 2..143 138 26.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:40:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18708-PA 234 GE18708-PA 38..234 6..202 973 95.4 Plus
Dyak\GE25782-PA 264 GE25782-PA 19..224 6..202 243 31.2 Plus