Clone RE38619 Report

Search the DGRC for RE38619

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:386
Well:19
Vector:pFlc-1
Associated Gene/Transcriptl(3)03670-RA
Protein status:RE38619.pep: gold
Preliminary Size:906
Sequenced Size:956

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1715 2001-12-14 Blastp of sequenced clone
CG1715 2002-01-01 Sim4 clustering to Release 2
CG1715 2003-01-01 Sim4 clustering to Release 3
l(3)03670 2008-04-29 Release 5.5 accounting
l(3)03670 2008-08-15 Release 5.9 accounting
l(3)03670 2008-12-18 5.12 accounting

Clone Sequence Records

RE38619.complete Sequence

956 bp (956 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071348

> RE38619.complete
TTTTCGTGCTTGCGCTTTAAGGTCACTCTGAGCACGTCTTATTTTTGTTG
GGTTGGCCCTGTAGTTTTTCACCGAAAAGGGTTTTGCTCCACGAACAGCA
GCTAGAGGAACTTCAAAGATGGGAGCCCGACAGTCTCAATCCCGCGAGCC
CCGAACCGTTTCGATGGAAAACCCAACTCCTGCCGGCGTTATTGATATAT
CCGACGATGTGGTCAAGCGACTGAAGGCGGGAATATCCCAGCAGGCTCGT
GAGCACGCAGCCGCTGCGGAGGAATCGAAACCAGTGCCCAAGCCAACGAC
GAAGGCTGCCGCCAAGCCAGCCGCATCCTCGCCAGCTGCTTCTCCTGCTC
CGAAAGTATCCTCCTATCCCGCTGCAGTGCCCATTTACGTCCAGGGAGGA
GGACACACCATTAGCGCGGCCGATGTGCAGCGCCAGATGAACCAGGAGCT
AATCAAGAATGACGAGCTGTGGAAGGAGCGCATGGCGAAGCTGGAGGAGA
ACCTCAAGAAGACCAACACCATCCTGGAGAAGGAGTACGCCAATGCTGTA
GAAAATGTGCACAAGCGATTCGTCAGCACCGCGTCGTCGCACAAAGTGCC
TCCCTGCCAGGACCTGAAATCCCAGCTGCTTGCCTGCTACCGCGCGCATC
CCGGGGAGACCTTGAAGTGCATTGAGGAGGTGGCCCAATTCCGACAGTGC
ATCGATCTTCATCGCGTCCAGAAGCTGGATGCGGAACCAGAGTCGTCGAA
AGTGACCTCCAAGGCCACCGTTCCTGCCAAGGCGGCCTAGGATCCTGGCA
AATCCTTTTGTCCTAATTTGTTGACTTTTCTTTGAGGCCCCTTATGGGTT
TTGTATAAACGATTGAGCGATCGATGGGGATGTACTCAAAACTTAAGCAA
AAGTGTCATTGCGAGCGATAGTAAACTAACTTAAATGAAACAAAAAAAAA
AAAAAA

RE38619.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:41:01
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)03670-RA 1045 l(3)03670-RA 41..983 1..943 4685 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:45:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 26875008..26875702 939..245 3355 98.8 Minus
chr3R 27901430 chr3R 26875977..26876142 245..80 800 98.8 Minus
chr3R 27901430 chr3R 26876226..26876307 82..1 410 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:53:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:45:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 31052610..31053308 943..245 3480 99.9 Minus
3R 32079331 3R 31053587..31053752 245..80 815 99.4 Minus
3R 32079331 3R 31053831..31053912 82..1 410 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:08:03
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 30793441..30794139 943..245 3480 99.8 Minus
3R 31820162 3R 30794418..30794583 245..80 815 99.3 Minus
3R 31820162 3R 30794662..30794743 82..1 410 100 Minus
Blast to na_te.dros performed on 2019-03-16 05:45:41 has no hits.

RE38619.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:46:34 Download gff for RE38619.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 26875006..26875701 246..941 98 <- Minus
chr3R 26875977..26876141 81..245 98 <- Minus
chr3R 26876228..26876307 1..80 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:13:59 Download gff for RE38619.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)03670-RA 1..672 119..790 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:05:59 Download gff for RE38619.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)03670-RA 1..672 119..790 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:28:56 Download gff for RE38619.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)03670-RA 1..672 119..790 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:30:34 Download gff for RE38619.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)03670-RA 1..672 119..790 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:07:45 Download gff for RE38619.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)03670-RA 1..672 119..790 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:34:11 Download gff for RE38619.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)03670-RA 1..941 1..941 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:05:58 Download gff for RE38619.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)03670-RA 1..941 1..941 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:28:56 Download gff for RE38619.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)03670-RA 4..940 1..937 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:30:34 Download gff for RE38619.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)03670-RA 1..941 1..941 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:07:45 Download gff for RE38619.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)03670-RA 4..940 1..937 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:46:34 Download gff for RE38619.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31052612..31053307 246..941 99 <- Minus
3R 31053587..31053751 81..245 99 <- Minus
3R 31053833..31053912 1..80 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:46:34 Download gff for RE38619.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31052612..31053307 246..941 99 <- Minus
3R 31053587..31053751 81..245 99 <- Minus
3R 31053833..31053912 1..80 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:46:34 Download gff for RE38619.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31052612..31053307 246..941 99 <- Minus
3R 31053587..31053751 81..245 99 <- Minus
3R 31053833..31053912 1..80 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:28:56 Download gff for RE38619.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26878334..26879029 246..941 99 <- Minus
arm_3R 26879309..26879473 81..245 99 <- Minus
arm_3R 26879555..26879634 1..80 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:06:50 Download gff for RE38619.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30793443..30794138 246..941 99 <- Minus
3R 30794418..30794582 81..245 99 <- Minus
3R 30794664..30794743 1..80 100   Minus

RE38619.pep Sequence

Translation from 118 to 789

> RE38619.pep
MGARQSQSREPRTVSMENPTPAGVIDISDDVVKRLKAGISQQAREHAAAA
EESKPVPKPTTKAAAKPAASSPAASPAPKVSSYPAAVPIYVQGGGHTISA
ADVQRQMNQELIKNDELWKERMAKLEENLKKTNTILEKEYANAVENVHKR
FVSTASSHKVPPCQDLKSQLLACYRAHPGETLKCIEEVAQFRQCIDLHRV
QKLDAEPESSKVTSKATVPAKAA*

RE38619.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:44:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23295-PA 228 GF23295-PA 1..205 1..204 859 82 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:44:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11893-PA 215 GG11893-PA 1..215 1..216 942 88.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:44:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14349-PA 228 GH14349-PA 1..210 1..210 761 71.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:13:23
Subject Length Description Subject Range Query Range Score Percent Strand
Chchd3-PA 223 CG1715-PA 1..223 1..223 1132 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:44:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10443-PA 222 GI10443-PA 1..199 1..204 831 76.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:44:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13968-PA 209 GL13968-PA 1..195 1..204 779 75.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:44:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14351-PA 209 GA14351-PA 1..202 1..211 789 74.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:44:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12111-PA 223 GM12111-PA 1..223 1..223 1043 96 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:44:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16654-PA 223 GD16654-PA 1..223 1..223 994 96 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:44:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10659-PA 220 GJ10659-PA 1..215 1..219 858 74 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:44:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22560-PA 226 GK22560-PA 1..220 1..218 802 72.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:44:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23341-PA 222 GE23341-PA 1..222 1..223 958 92.8 Plus

RE38619.hyp Sequence

Translation from 118 to 789

> RE38619.hyp
MGARQSQSREPRTVSMENPTPAGVIDISDDVVKRLKAGISQQAREHAAAA
EESKPVPKPTTKAAAKPAASSPAASPAPKVSSYPAAVPIYVQGGGHTISA
ADVQRQMNQELIKNDELWKERMAKLEENLKKTNTILEKEYANAVENVHKR
FVSTASSHKVPPCQDLKSQLLACYRAHPGETLKCIEEVAQFRQCIDLHRV
QKLDAEPESSKVTSKATVPAKAA*

RE38619.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:02:12
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)03670-PA 223 CG1715-PA 1..223 1..223 1132 100 Plus