Clone RE38722 Report

Search the DGRC for RE38722

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:387
Well:22
Vector:pFlc-1
Associated Gene/TranscriptCG7916-RA
Protein status:RE38722.pep: gold
Preliminary Size:864
Sequenced Size:959

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7916 2002-01-01 Sim4 clustering to Release 2
CG7916 2002-04-21 Blastp of sequenced clone
CG7916 2003-01-01 Sim4 clustering to Release 3
CG7916 2008-04-29 Release 5.5 accounting
CG7916 2008-08-15 Release 5.9 accounting
CG7916 2008-12-18 5.12 accounting

Clone Sequence Records

RE38722.complete Sequence

959 bp (959 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113463

> RE38722.complete
GATCAGGTGGCTGGCTATACAATGAAAGCTATCGTTTGTGTTTTTGTGAC
CCTTTTGGCCTGCGTAGCGGCCTACGATGTGGAGCTGCTCACCGAGGAGC
AATGGGACCAGCTGGTGGCGCGTAATCCCGCCAAGCCCGATACTCAGGGT
CTGATCTTGAACGGATCGGTGAAGAAGGCCATCAATGGACTGCTGAACCA
AATGCCTTGTGGTTGGCCCCAATATGGAATTCCACCACTGGATCCCTACA
CCAATGCTGATCTCCGCATCCACTTGGCCGAGTCGGTTGTCGATACCCTG
CTGCAGTTCCTGCGCTTCCGTTTCGATGGCCTGGAAGGCATGGAGATCAA
GAAGATGAAGGTCAGCTACACCTTTAGCAAGAAGGTCAAGTTCCACTTCA
ACTTCCCAGAGCTGAAGGCCAGTGCCCACTATTTGGACACCAACACCTTT
GTGAATCTGCTGAAGGAACTGGGATTGTCGGTGCGCTACGAGAGCTCGGG
CCCATTGTCCTTCAGCCTGCAGAATCTGTCGATTCAGGGCGAGTTCAAGT
ACAAGATGCCCTTCATCTTTGGCTCCATCAAGATCTACAAGTTCAGTTGC
GCCGTCGGCTTGGGCGGTGTATCCTCGAACATTGGCGGTGTAATGGGAAA
TGGAAGGATCAATGAGTTCATCAACGACATGCTCGACAAGGAGATCCCGG
CCTTCATCAATGGCAACCAGGAACAGATCAGCGCCAAGATCGAGGAGATC
TTTGTGCCGCTGGCCAATGCGCATCTCACGGGTCACAAGATCTGGTATCT
CTTTAGCTTGCTGTCCGCCACCACTGGCAGTTGCAATCCCACTCCCGCTC
CCTGGTTGGCCATTGAGTCCAGGAAGCTAGACTAAGGCAACACCAGCCAA
TAAAAAGCAATTCAAACGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAA

RE38722.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:14:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG7916-RA 1041 CG7916-RA 50..967 2..919 4590 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:11:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 13845905..13846529 294..918 3125 100 Plus
chr2L 23010047 chr2L 13845684..13845849 128..293 830 100 Plus
chr2L 23010047 chr2L 13845488..13845613 2..127 630 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:53:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:11:19
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13847175..13847800 294..919 3130 100 Plus
2L 23513712 2L 13846954..13847119 128..293 830 100 Plus
2L 23513712 2L 13846758..13846883 2..127 630 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:44:27
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13847175..13847800 294..919 3130 100 Plus
2L 23513712 2L 13846954..13847119 128..293 830 100 Plus
2L 23513712 2L 13846758..13846883 2..127 630 100 Plus
Blast to na_te.dros performed on 2019-03-16 21:11:19 has no hits.

RE38722.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:12:37 Download gff for RE38722.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 13845487..13845613 1..127 99 -> Plus
chr2L 13845684..13845849 128..293 100 -> Plus
chr2L 13845905..13846529 294..918 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:14:05 Download gff for RE38722.complete
Subject Subject Range Query Range Percent Splice Strand
CG7916-RA 1..864 22..885 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:00:15 Download gff for RE38722.complete
Subject Subject Range Query Range Percent Splice Strand
CG7916-RA 1..864 22..885 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:34:51 Download gff for RE38722.complete
Subject Subject Range Query Range Percent Splice Strand
CG7916-RA 1..864 22..885 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:53:32 Download gff for RE38722.complete
Subject Subject Range Query Range Percent Splice Strand
CG7916-RA 1..864 22..885 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:09:52 Download gff for RE38722.complete
Subject Subject Range Query Range Percent Splice Strand
CG7916-RA 1..864 22..885 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:41:14 Download gff for RE38722.complete
Subject Subject Range Query Range Percent Splice Strand
CG7916-RA 1..918 2..918 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:00:15 Download gff for RE38722.complete
Subject Subject Range Query Range Percent Splice Strand
CG7916-RA 1..917 2..918 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:34:51 Download gff for RE38722.complete
Subject Subject Range Query Range Percent Splice Strand
CG7916-RA 6..923 1..918 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:53:32 Download gff for RE38722.complete
Subject Subject Range Query Range Percent Splice Strand
CG7916-RA 1..918 2..918 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:09:52 Download gff for RE38722.complete
Subject Subject Range Query Range Percent Splice Strand
CG7916-RA 6..923 1..918 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:12:37 Download gff for RE38722.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13846757..13846883 1..127 99 -> Plus
2L 13846954..13847119 128..293 100 -> Plus
2L 13847175..13847799 294..918 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:12:37 Download gff for RE38722.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13846757..13846883 1..127 99 -> Plus
2L 13846954..13847119 128..293 100 -> Plus
2L 13847175..13847799 294..918 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:12:37 Download gff for RE38722.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13846757..13846883 1..127 99 -> Plus
2L 13846954..13847119 128..293 100 -> Plus
2L 13847175..13847799 294..918 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:34:51 Download gff for RE38722.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13846757..13846883 1..127 99 -> Plus
arm_2L 13846954..13847119 128..293 100 -> Plus
arm_2L 13847175..13847799 294..918 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:25:44 Download gff for RE38722.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13847175..13847799 294..918 100   Plus
2L 13846757..13846883 1..127 99 -> Plus
2L 13846954..13847119 128..293 100 -> Plus

RE38722.hyp Sequence

Translation from 0 to 884

> RE38722.hyp
NQVAGYTMKAIVCVFVTLLACVAAYDVELLTEEQWDQLVARNPAKPDTQG
LILNGSVKKAINGLLNQMPCGWPQYGIPPLDPYTNADLRIHLAESVVDTL
LQFLRFRFDGLEGMEIKKMKVSYTFSKKVKFHFNFPELKASAHYLDTNTF
VNLLKELGLSVRYESSGPLSFSLQNLSIQGEFKYKMPFIFGSIKIYKFSC
AVGLGGVSSNIGGVMGNGRINEFINDMLDKEIPAFINGNQEQISAKIEEI
FVPLANAHLTGHKIWYLFSLLSATTGSCNPTPAPWLAIESRKLD*

RE38722.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:22:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG7916-PA 287 CG7916-PA 1..287 8..294 1499 100 Plus
CG7953-PB 297 CG7953-PB 36..296 26..285 434 36.3 Plus
CG7953-PA 297 CG7953-PA 36..296 26..285 434 36.3 Plus
CG8997-PB 260 CG8997-PB 28..229 53..259 277 31.4 Plus
CG8997-PA 260 CG8997-PA 28..229 53..259 277 31.4 Plus

RE38722.pep Sequence

Translation from 21 to 884

> RE38722.pep
MKAIVCVFVTLLACVAAYDVELLTEEQWDQLVARNPAKPDTQGLILNGSV
KKAINGLLNQMPCGWPQYGIPPLDPYTNADLRIHLAESVVDTLLQFLRFR
FDGLEGMEIKKMKVSYTFSKKVKFHFNFPELKASAHYLDTNTFVNLLKEL
GLSVRYESSGPLSFSLQNLSIQGEFKYKMPFIFGSIKIYKFSCAVGLGGV
SSNIGGVMGNGRINEFINDMLDKEIPAFINGNQEQISAKIEEIFVPLANA
HLTGHKIWYLFSLLSATTGSCNPTPAPWLAIESRKLD*

RE38722.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:43:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14264-PA 287 GF14264-PA 1..287 1..287 1337 85 Plus
Dana\GF14265-PA 296 GF14265-PA 53..295 45..278 438 38.1 Plus
Dana\GF15613-PA 259 GF15613-PA 31..229 49..252 279 32.9 Plus
Dana\GF14266-PA 250 GF14266-PA 36..230 60..259 163 25.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:43:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23891-PA 287 GG23891-PA 1..287 1..287 1465 94.1 Plus
Dere\GG23892-PA 297 GG23892-PA 54..296 45..278 441 38.1 Plus
Dere\GG10175-PA 261 GG10175-PA 28..226 46..249 281 31.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:43:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11121-PA 278 GH11121-PA 1..278 1..278 1093 69.8 Plus
Dgri\GH11122-PA 301 GH11122-PA 37..300 16..278 426 36.3 Plus
Dgri\GH10611-PA 258 GH10611-PA 28..229 46..252 297 32.5 Plus
Dgri\GH11123-PA 245 GH11123-PA 21..225 44..259 164 25 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:32:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG7916-PA 287 CG7916-PA 1..287 1..287 1499 100 Plus
CG7953-PB 297 CG7953-PB 36..296 19..278 434 36.3 Plus
CG7953-PA 297 CG7953-PA 36..296 19..278 434 36.3 Plus
CG8997-PB 260 CG8997-PB 28..229 46..252 277 31.4 Plus
CG8997-PA 260 CG8997-PA 28..229 46..252 277 31.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:43:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12593-PA 282 GI12593-PA 1..282 1..282 1079 68.1 Plus
Dmoj\GI12604-PA 298 GI12604-PA 51..297 41..278 452 37.9 Plus
Dmoj\GI17402-PA 256 GI17402-PA 28..229 46..252 292 32.9 Plus
Dmoj\GI17403-PA 245 GI17403-PA 46..245 60..267 179 27 Plus
Dmoj\GI12614-PA 249 GI12614-PA 37..229 60..259 165 26 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:43:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21240-PA 287 GL21240-PA 1..285 1..285 1270 79.3 Plus
Dper\GL21241-PA 297 GL21241-PA 4..296 5..278 432 34.6 Plus
Dper\GL21075-PA 258 GL21075-PA 28..226 46..249 273 29.4 Plus
Dper\GL21242-PA 250 GL21242-PA 36..230 60..259 175 25.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:43:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20684-PA 287 GA20684-PA 1..285 1..285 1270 79.3 Plus
Dpse\GA20716-PA 297 GA20716-PA 4..296 5..278 433 35.6 Plus
Dpse\GA21464-PA 258 GA21464-PA 28..226 46..249 274 29.4 Plus
Dpse\GA20729-PA 250 GA20729-PA 36..230 60..259 172 25.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:43:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15309-PA 261 GM15309-PA 1..232 1..232 1218 98.7 Plus
Dsec\GM15320-PA 297 GM15320-PA 3..296 8..278 451 36.3 Plus
Dsec\GM15045-PA 258 GM15045-PA 22..258 36..278 284 28.9 Plus
Dsec\GM15330-PA 250 GM15330-PA 36..230 60..259 158 27.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:43:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23932-PA 287 GD23932-PA 1..287 1..287 1496 97.6 Plus
Dsim\GD23933-PA 289 GD23933-PA 3..288 8..278 420 35.3 Plus
Dsim\GD23934-PA 250 GD23934-PA 36..230 60..259 159 27.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:43:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18151-PA 282 GJ18151-PA 1..282 1..282 1096 68.1 Plus
Dvir\GJ18152-PA 301 GJ18152-PA 58..300 45..278 426 34.8 Plus
Dvir\GJ18080-PA 256 GJ18080-PA 28..226 46..249 264 28.9 Plus
Dvir\GJ18083-PA 247 GJ18083-PA 46..242 60..264 155 24.2 Plus
Dvir\GJ18153-PA 251 GJ18153-PA 37..231 60..259 154 24.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:43:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15013-PA 287 GK15013-PA 1..285 1..285 1218 76.1 Plus
Dwil\GK15016-PA 298 GK15016-PA 55..297 45..278 438 38.1 Plus
Dwil\GK15116-PA 258 GK15116-PA 28..229 46..252 262 29.5 Plus
Dwil\GK15017-PA 253 GK15017-PA 39..233 60..259 148 24.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:43:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18690-PA 287 GE18690-PA 1..287 1..287 1486 96.5 Plus
Dyak\GE18691-PA 297 GE18691-PA 54..296 45..278 458 38.9 Plus
Dyak\GE11368-PA 259 GE11368-PA 28..229 46..252 278 30.9 Plus
Dyak\GE18692-PA 250 GE18692-PA 36..230 60..259 163 27.9 Plus