Clone RE39031 Report

Search the DGRC for RE39031

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:390
Well:31
Vector:pFlc-1
Associated Gene/TranscriptCG5023-RA
Protein status:RE39031.pep: gold
Preliminary Size:707
Sequenced Size:794

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5023 2002-01-01 Sim4 clustering to Release 2
CG5023 2002-02-22 Blastp of sequenced clone
CG5023 2003-01-01 Sim4 clustering to Release 3
CG5023 2008-04-29 Release 5.5 accounting
CG5023 2008-08-15 Release 5.9 accounting
CG5023 2008-12-18 5.12 accounting

Clone Sequence Records

RE39031.complete Sequence

794 bp (794 high quality bases) assembled on 2002-02-22

GenBank Submission: AY084164

> RE39031.complete
AGTTGAAATTTGTGTCTCAAACGCGCCACACGCTAATTTGCATTTGCATT
TCACTTTCAAATCTAATAATTCACAATGGCTCCACGCAACAAGGAACAGG
AACAGGAAGTGCTCAACTGGGTGTTCGCCGTGATTGGCGAGAAGGTCCCC
AGCGGGCAGTACGAGGACATTCTCAAGGACGGCATCTGGCTGTGCAAGCT
GGCCAACAAACTGGCCCCCGGATCGGTGAAGAAGATCCAGGAGCGCGGCA
CCAACTTCCAACTGATGGAGAACATCCAGCGTTTCCAGGCAGCGGTCAAG
AAGTACGGTGTGCCCGAGGAGGAGATCTTCCAAACCGCCGATCTTTTCGA
GCGTCGCAACATCCCCCAGGTCACCCTCTCCCTGTACGCCCTTGGACGCA
TCACGCAAAAGCACCCCGAGTACACTGGCCCCACACTGGGACCCAAGATG
GCCGACAAGAACGAGCGCAGCTTCACCGAAGAGCAGCTCCGTGCCCACGA
GGGTGAGCTCAACCTGCAGATGGGCTTCAACAAGGGCGCCTCGCAGGCTG
GACACGGTGGTATGGGCAACACCCGCCACATGTAAGGCACCACCATCCCA
ACCGATCCCGGAAAGAAAAACACCACAACACACTCAACCACACAAACACC
GAAATCTAATTAGTTCAAACAAAAAGTGGGTTTTGTATCTCGTGCGTCAT
GGCGCATGATTTAAGCAGTGCCAAGCTCTAAATGTAATTTATATAATATG
AAACAAATAAATTAATTAATTTTAATATAAAAAAAAAAAAAAAA

RE39031.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:56:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG5023-RA 833 CG5023-RA 47..827 1..781 3890 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:11:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 15998484..15998859 403..778 1865 99.7 Plus
chr3R 27901430 chr3R 15998080..15998400 82..402 1605 100 Plus
chr3R 27901430 chr3R 15993431..15993511 1..81 405 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:54:12 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:11:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20174491..20174869 403..781 1880 99.7 Plus
3R 32079331 3R 20174091..20174411 82..402 1605 100 Plus
3R 32079331 3R 20169440..20169520 1..81 405 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:15:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 19915322..19915700 403..781 1880 99.7 Plus
3R 31820162 3R 19914922..19915242 82..402 1605 100 Plus
3R 31820162 3R 19910271..19910351 1..81 405 100 Plus
Blast to na_te.dros performed 2019-03-16 21:11:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Tv1 6868 Dvir\Tv1 6868bp Derived from AF056940 (Rel. 62, Last updated, Version 4). 5792..5842 721..775 121 74.5 Plus
Stalker2 7672 Stalker2 STALKER2 7672bp 1415..1460 778..733 113 71.7 Minus
TART-A 13424 TART-A 13424bp 2669..2744 572..648 112 62.3 Plus

RE39031.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:12:38 Download gff for RE39031.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 15998080..15998400 82..402 100 -> Plus
chr3R 15993431..15993511 1..81 100 -> Plus
chr3R 15998484..15998815 403..734 99 == Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:54:24 Download gff for RE39031.complete
Subject Subject Range Query Range Percent Splice Strand
CG5023-RA 1..510 76..585 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:34:56 Download gff for RE39031.complete
Subject Subject Range Query Range Percent Splice Strand
CG5023-RA 1..510 76..585 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:36:54 Download gff for RE39031.complete
Subject Subject Range Query Range Percent Splice Strand
CG5023-RA 1..510 76..585 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:09:56 Download gff for RE39031.complete
Subject Subject Range Query Range Percent Splice Strand
CG5023-RA 1..510 76..585 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:07:13 Download gff for RE39031.complete
Subject Subject Range Query Range Percent Splice Strand
CG5023-RA 5..782 1..778 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:54:23 Download gff for RE39031.complete
Subject Subject Range Query Range Percent Splice Strand
CG5023-RA 5..782 1..778 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:34:56 Download gff for RE39031.complete
Subject Subject Range Query Range Percent Splice Strand
CG5023-RA 6..783 1..778 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:36:55 Download gff for RE39031.complete
Subject Subject Range Query Range Percent Splice Strand
CG5023-RA 5..782 1..778 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:09:56 Download gff for RE39031.complete
Subject Subject Range Query Range Percent Splice Strand
CG5023-RA 6..783 1..778 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:12:38 Download gff for RE39031.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20169440..20169520 1..81 100 -> Plus
3R 20174091..20174411 82..402 100 -> Plus
3R 20174491..20174866 403..778 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:12:38 Download gff for RE39031.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20169440..20169520 1..81 100 -> Plus
3R 20174091..20174411 82..402 100 -> Plus
3R 20174491..20174866 403..778 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:12:38 Download gff for RE39031.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20169440..20169520 1..81 100 -> Plus
3R 20174091..20174411 82..402 100 -> Plus
3R 20174491..20174866 403..778 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:34:56 Download gff for RE39031.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15995162..15995242 1..81 100 -> Plus
arm_3R 15999813..16000133 82..402 100 -> Plus
arm_3R 16000213..16000588 403..778 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:19:39 Download gff for RE39031.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19914922..19915242 82..402 100 -> Plus
3R 19915322..19915697 403..778 99   Plus
3R 19910271..19910351 1..81 100 -> Plus

RE39031.pep Sequence

Translation from 75 to 584

> RE39031.pep
MAPRNKEQEQEVLNWVFAVIGEKVPSGQYEDILKDGIWLCKLANKLAPGS
VKKIQERGTNFQLMENIQRFQAAVKKYGVPEEEIFQTADLFERRNIPQVT
LSLYALGRITQKHPEYTGPTLGPKMADKNERSFTEEQLRAHEGELNLQMG
FNKGASQAGHGGMGNTRHM*

RE39031.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:06:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17639-PA 169 GF17639-PA 1..169 1..169 879 95.9 Plus
Dana\GF13684-PA 184 GF13684-PA 15..172 4..160 436 51.3 Plus
Dana\GF23888-PA 188 GF23888-PA 24..188 5..169 397 47.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:06:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23757-PA 169 GG23757-PA 1..169 1..169 903 100 Plus
Dere\GG20371-PA 184 GG20371-PA 15..172 4..160 450 53.2 Plus
Dere\GG14221-PA 188 GG14221-PA 24..188 5..169 396 47.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:06:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23202-PA 243 GH23202-PA 77..243 3..169 875 95.2 Plus
Dgri\GH21621-PA 184 GH21621-PA 15..172 4..160 451 53.8 Plus
Dgri\GH15556-PA 188 GH15556-PA 24..188 5..169 388 46.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG5023-PA 169 CG5023-PA 1..169 1..169 887 100 Plus
Mp20-PA 184 CG4696-PA 15..171 4..159 441 53.5 Plus
Mp20-PC 189 CG4696-PC 15..171 4..159 441 53.5 Plus
Chd64-PC 175 CG14996-PC 11..175 5..169 379 47.9 Plus
Chd64-PB 188 CG14996-PB 24..188 5..169 379 47.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:06:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22717-PA 169 GI22717-PA 1..169 1..169 868 94.7 Plus
Dmoj\GI20073-PA 184 GI20073-PA 15..172 4..160 436 52.5 Plus
Dmoj\GI16831-PA 188 GI16831-PA 24..188 5..169 401 47.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:06:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12090-PA 266 GL12090-PA 1..156 1..156 820 97.4 Plus
Dper\GL11002-PA 184 GL11002-PA 15..172 4..160 448 53.2 Plus
Dper\GL12739-PA 188 GL12739-PA 24..188 5..169 390 46.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:06:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18602-PA 169 GA18602-PA 1..169 1..169 875 95.9 Plus
Dpse\GA18362-PA 184 GA18362-PA 15..172 4..160 448 53.2 Plus
Dpse\GA13413-PA 188 GA13413-PA 24..188 5..169 390 46.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:06:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23099-PA 182 GM23099-PA 16..182 3..169 894 100 Plus
Dsec\GM14014-PA 188 GM14014-PA 24..188 5..169 396 47.9 Plus
Dsec\GM21458-PA 216 GM21458-PA 15..192 4..169 359 42.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:06:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19339-PA 106 GD19339-PA 1..106 64..169 565 100 Plus
Dsim\GD10956-PA 184 GD10956-PA 15..172 4..160 446 52.5 Plus
Dsim\GD13293-PA 74 GD13293-PA 17..74 111..169 152 52.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:06:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23442-PA 214 GJ23442-PA 46..214 1..169 877 95.3 Plus
Dvir\GJ21167-PA 184 GJ21167-PA 15..172 4..160 462 54.4 Plus
Dvir\GJ12578-PA 188 GJ12578-PA 24..188 5..169 393 47.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:06:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22375-PA 169 GK22375-PA 1..169 1..169 872 94.7 Plus
Dwil\GK17978-PA 184 GK17978-PA 15..172 4..160 447 53.2 Plus
Dwil\GK10106-PA 188 GK10106-PA 24..188 5..169 391 47.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:06:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25653-PA 117 GE25653-PA 1..110 1..110 571 98.2 Plus
Dyak\Mp20-PA 184 GE12530-PA 15..172 4..160 447 52.5 Plus
Dyak\GE20649-PA 188 GE20649-PA 24..188 5..169 396 47.9 Plus

RE39031.hyp Sequence

Translation from 75 to 584

> RE39031.hyp
MAPRNKEQEQEVLNWVFAVIGEKVPSGQYEDILKDGIWLCKLANKLAPGS
VKKIQERGTNFQLMENIQRFQAAVKKYGVPEEEIFQTADLFERRNIPQVT
LSLYALGRITQKHPEYTGPTLGPKMADKNERSFTEEQLRAHEGELNLQMG
FNKGASQAGHGGMGNTRHM*

RE39031.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:02:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG5023-PA 169 CG5023-PA 1..169 1..169 887 100 Plus
Mp20-PA 184 CG4696-PA 15..171 4..159 441 53.5 Plus
Mp20-PC 189 CG4696-PC 15..171 4..159 441 53.5 Plus
Chd64-PC 175 CG14996-PC 11..175 5..169 379 47.9 Plus
Chd64-PB 188 CG14996-PB 24..188 5..169 379 47.9 Plus