BDGP Sequence Production Resources |
Search the DGRC for RE39082
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 390 |
Well: | 82 |
Vector: | pFlc-1 |
Associated Gene/Transcript | ImpE1-RB |
Protein status: | RE39082.pep: gold |
Preliminary Size: | 135 |
Sequenced Size: | 931 |
Gene | Date | Evidence |
---|---|---|
CG13669 | 2002-01-01 | Sim4 clustering to Release 2 |
CG32356 | 2002-04-04 | Blastp of sequenced clone |
CG32356 | 2003-01-01 | Sim4 clustering to Release 3 |
ImpE1 | 2008-04-29 | Release 5.5 accounting |
ImpE1 | 2008-08-15 | Release 5.9 accounting |
ImpE1 | 2008-12-18 | 5.12 accounting |
931 bp (931 high quality bases) assembled on 2002-04-04
GenBank Submission: AY095083
> RE39082.complete TGAGTTCGTTGCTGACCATCGTTACGTGCGGACGTGCCCAGCTCAGCTCA TCTTCGTGTGATGTGGCTGCACTTTGCACACTAAACTTAAGATCTGAGCC CAAAACGTTTTCCAAGCTGCAAAAATATAACAAAAGTGCCGCGACGCGTG TGACAAACGAAAATCGAGTAAAACGCGAAAAACATATATTTACGACTGCA ACGAGAGGAATACCAGCTACAGGAAAATAACCCAAGAAAAGCGGCTGAAA AATCGAAAAAACCAAAAGAAAACACACAAAAGGAGGGAAAAGCGAGAAAA GCCTTCCCAGGGAGATCCAAAGCAGCTTCTTTGGAGATTCAGAAGCGGCA ATGACGGCGACTGCGAGGCAGTCGGCAACATCGAGAAAGCAACCTGCGAT CGCAATGCTCAATGGAAACGCTTTTACGGTTAAGCGGCTCTTAGCGCTGC TGATCATCTTCACAGTGGTGGACGCGAGTCGATCCCTGGAGCTGGGCGAC AAGTGCCAGCATGACATGGACTGCACGGATTTCATCAAGGGCAGCAGCTG CTCCGCCCTCGGATACTGCGAGTGCGCCCCCTACTTCGTCCAGTTGGATT CCAAGCGCTGTTTGTCATCCCAGCTCCTTGGCGGCGACTGCCAGCTGAGC GAGCAGTGCTCCATGAAGGTGGCCAATAGCAGTTGTCTGGAGGGTGCATG CCGCTGCGTCGAGGGATTCCTGCAGTTCCGCAAGCACACCTGTCTGGGAC GTAAGTATCAGCCGACCGCCGGCCAGCTATTGTGGCCCTAATTCTCACCA GATTGCCCGGGACTACTTACTCATATACTACAGATAATACAATTAACTGT TTGGCATGCGGTCTTTTGGTGTATTGCAATAAACGGACAGCCGGGCAGCC GACTAATAATCCCCCAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
ImpE1-RB | 1006 | ImpE1-RB | 18..931 | 3..916 | 4570 | 100 | Plus |
ImpE1-RA | 6131 | ImpE1-RA | 85..832 | 3..750 | 3740 | 100 | Plus |
ImpE1.c | 971 | ImpE1.c | 231..971 | 175..915 | 3705 | 100 | Plus |
ImpE1.c | 971 | ImpE1.c | 3..175 | 3..175 | 865 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 8371838..8372140 | 619..915 | 1375 | 97.7 | Plus |
chr3L | 24539361 | chr3L | 8366803..8367073 | 175..446 | 1295 | 99.3 | Plus |
chr3L | 24539361 | chr3L | 8364425..8364597 | 3..175 | 865 | 100 | Plus |
chr3L | 24539361 | chr3L | 8371129..8371301 | 446..618 | 865 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 8379854..8380151 | 619..916 | 1490 | 100 | Plus |
3L | 28110227 | 3L | 8374800..8375071 | 175..446 | 1360 | 100 | Plus |
3L | 28110227 | 3L | 8372411..8372583 | 3..175 | 865 | 100 | Plus |
3L | 28110227 | 3L | 8379144..8379316 | 446..618 | 865 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 8372954..8373251 | 619..916 | 1490 | 100 | Plus |
3L | 28103327 | 3L | 8367900..8368171 | 175..446 | 1360 | 100 | Plus |
3L | 28103327 | 3L | 8372244..8372416 | 446..618 | 865 | 100 | Plus |
3L | 28103327 | 3L | 8365511..8365683 | 3..175 | 865 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 8364423..8364597 | 1..175 | 99 | -> | Plus |
chr3L | 8366804..8367073 | 176..446 | 99 | -> | Plus |
chr3L | 8371130..8371301 | 447..618 | 100 | -> | Plus |
chr3L | 8371838..8372140 | 619..915 | 97 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ImpE1-RB | 1..441 | 351..791 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ImpE1-RB | 1..441 | 351..791 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ImpE1-RB | 1..441 | 351..791 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ImpE1-RB | 1..441 | 351..791 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ImpE1-RB | 1..441 | 351..791 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ImpE1-RB | 1..915 | 1..915 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ImpE1-RB | 1..915 | 1..915 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ImpE1-RB | 5..919 | 1..915 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ImpE1-RB | 1..915 | 1..915 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ImpE1-RB | 5..919 | 1..915 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8372409..8372583 | 1..175 | 99 | -> | Plus |
3L | 8374801..8375071 | 176..446 | 100 | -> | Plus |
3L | 8379145..8379316 | 447..618 | 100 | -> | Plus |
3L | 8379854..8380150 | 619..915 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8372409..8372583 | 1..175 | 99 | -> | Plus |
3L | 8374801..8375071 | 176..446 | 100 | -> | Plus |
3L | 8379145..8379316 | 447..618 | 100 | -> | Plus |
3L | 8379854..8380150 | 619..915 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8372409..8372583 | 1..175 | 99 | -> | Plus |
3L | 8374801..8375071 | 176..446 | 100 | -> | Plus |
3L | 8379145..8379316 | 447..618 | 100 | -> | Plus |
3L | 8379854..8380150 | 619..915 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 8365509..8365683 | 1..175 | 99 | -> | Plus |
arm_3L | 8372954..8373250 | 619..915 | 100 | Plus | |
arm_3L | 8367901..8368171 | 176..446 | 100 | -> | Plus |
arm_3L | 8372245..8372416 | 447..618 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8367901..8368171 | 176..446 | 100 | -> | Plus |
3L | 8372245..8372416 | 447..618 | 100 | -> | Plus |
3L | 8372954..8373250 | 619..915 | 100 | Plus | |
3L | 8365509..8365683 | 1..175 | 99 | -> | Plus |
Translation from 350 to 790
> RE39082.pep MTATARQSATSRKQPAIAMLNGNAFTVKRLLALLIIFTVVDASRSLELGD KCQHDMDCTDFIKGSSCSALGYCECAPYFVQLDSKRCLSSQLLGGDCQLS EQCSMKVANSSCLEGACRCVEGFLQFRKHTCLGRKYQPTAGQLLWP*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24392-PA | 1588 | GF24392-PA | 1..115 | 19..133 | 595 | 95.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14308-PA | 1617 | GG14308-PA | 1..133 | 1..133 | 707 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15060-PA | 1617 | GH15060-PA | 15..136 | 12..133 | 560 | 83.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
ImpE1-PB | 146 | CG32356-PB | 1..146 | 1..146 | 775 | 100 | Plus |
ImpE1-PC | 1616 | CG32356-PC | 1..133 | 1..133 | 700 | 100 | Plus |
ImpE1-PA | 1616 | CG32356-PA | 1..133 | 1..133 | 700 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12827-PA | 1733 | GI12827-PA | 1..134 | 1..133 | 576 | 82.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24700-PA | 1665 | GL24700-PA | 19..141 | 12..133 | 609 | 93.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA16846-PA | 1658 | GA16846-PA | 25..147 | 12..133 | 610 | 93.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25050-PA | 1592 | GM25050-PA | 1..156 | 1..133 | 675 | 85.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14087-PA | 576 | GD14087-PA | 1..133 | 1..133 | 696 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12968-PA | 1640 | GJ12968-PA | 1..134 | 1..133 | 585 | 82.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK17755-PA | 1682 | GK17755-PA | 22..136 | 19..133 | 518 | 81.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE20737-PA | 1668 | GE20737-PA | 1..133 | 1..133 | 716 | 100 | Plus |
Translation from 350 to 790
> RE39082.hyp MTATARQSATSRKQPAIAMLNGNAFTVKRLLALLIIFTVVDASRSLELGD KCQHDMDCTDFIKGSSCSALGYCECAPYFVQLDSKRCLSSQLLGGDCQLS EQCSMKVANSSCLEGACRCVEGFLQFRKHTCLGRKYQPTAGQLLWP*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
ImpE1-PB | 146 | CG32356-PB | 1..146 | 1..146 | 775 | 100 | Plus |
ImpE1-PC | 1616 | CG32356-PC | 1..133 | 1..133 | 700 | 100 | Plus |
ImpE1-PA | 1616 | CG32356-PA | 1..133 | 1..133 | 700 | 100 | Plus |