Clone RE39106 Report

Search the DGRC for RE39106

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:391
Well:6
Vector:pFlc-1
Associated Gene/TranscriptmRpS33-RA
Protein status:RE39106.pep: gold
Preliminary Size:342
Sequenced Size:502

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10406 2002-01-01 Sim4 clustering to Release 2
CG10406 2003-01-01 Sim4 clustering to Release 3
CG10406 2004-10-25 Blastp of sequenced clone
mRpS33 2008-04-29 Release 5.5 accounting
mRpS33 2008-08-15 Release 5.9 accounting
mRpS33 2008-12-18 5.12 accounting

Clone Sequence Records

RE39106.complete Sequence

502 bp (502 high quality bases) assembled on 2006-06-05

GenBank Submission: BT016004

> RE39106.complete
ACTTGGAAATCAGCTGTCGCTTGTTTTTGTTTCGTGACATAACCGCAATT
TACTAAAACTTAGAAACTTAACTTAAATTATTTCATGAAAAGCATAGCAA
ACTAATATTAACTATGTCCCACAAGTACACGGAGCTGATTAAGGTCGGCA
CGCAGTATGCTCGCCGGATGAACTACCTCTCAAATCGCATTTTCGGCGAA
GTGGCTCGCACCACAAACGAGAAGTCCATGAAGGTGGTTCGCATGTTCTC
GGAGGAACCAATTCACAAACGGGACTACGTGATCAACTGGTATCCGCGGC
ACGTGGAGACGCACTTGCTGATGAAGAACCTTCGCGACTACGGACTGTTC
CGCGATGAGCACCAGGACTTCAAGGAGGAGATGAAGCGTCTGCGCAAGCT
GCGCGGCAAGGCGCCTCCCAAGAAGGGCGAGGGCAAGCGGGCCTCAAAGA
AGTAGTAAAATAAATATTCTAACATCCACTTTTATTGAAAAAAAAAAAAA
AA

RE39106.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:14:18
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS33-RA 582 mRpS33-RA 79..567 1..489 2445 100 Plus
CG14881-RA 1070 CG14881-RA 1021..1070 489..440 250 100 Minus
CG14881.a 1078 CG14881.a 1029..1078 489..440 250 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:21:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 12260735..12260990 487..232 1280 100 Minus
chr3R 27901430 chr3R 12261049..12261283 235..1 1145 99.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:54:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:21:00
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 16436043..16436300 489..232 1290 100 Minus
3R 32079331 3R 16436359..16436593 235..1 1175 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:07:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 16176874..16177131 489..232 1290 100 Minus
3R 31820162 3R 16177190..16177424 235..1 1175 100 Minus
Blast to na_te.dros performed 2019-03-15 18:21:01
Subject Length Description Subject Range Query Range Score Percent Strand
HeT-A 6083 HeT-A DM06920 6083bp Derived from U06920.2 (Rel. 67, Last updated, Version 14). 5779..5826 117..70 114 70.8 Minus
TAHRE 10463 TAHRE OSV 10463bp 5688..5782 34..133 110 61.4 Plus
I-element 5371 I-element DMIFACA 5371bp Derived from M14954 (g157749) (Rel. 44, Last updated, Version 2). 1783..1827 36..80 108 71.1 Plus

RE39106.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:22:05 Download gff for RE39106.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 12260735..12260988 234..487 100 <- Minus
chr3R 12261051..12261283 1..233 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:14:24 Download gff for RE39106.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS33-RA 1..342 114..455 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:23:43 Download gff for RE39106.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS33-RA 1..342 114..455 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:59:37 Download gff for RE39106.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS33-RA 1..342 114..455 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:42:31 Download gff for RE39106.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS33-RA 1..342 114..455 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:58:52 Download gff for RE39106.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS33-RA 1..342 114..455 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:51:59 Download gff for RE39106.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS33-RA 1..487 1..487 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:23:42 Download gff for RE39106.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS33-RA 1..487 1..487 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:59:37 Download gff for RE39106.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS33-RA 5..491 1..487 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:42:31 Download gff for RE39106.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS33-RA 1..487 1..487 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:58:52 Download gff for RE39106.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS33-RA 5..491 1..487 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:22:05 Download gff for RE39106.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16436045..16436298 234..487 100 <- Minus
3R 16436361..16436593 1..233 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:22:05 Download gff for RE39106.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16436045..16436298 234..487 100 <- Minus
3R 16436361..16436593 1..233 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:22:05 Download gff for RE39106.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16436045..16436298 234..487 100 <- Minus
3R 16436361..16436593 1..233 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:59:37 Download gff for RE39106.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12261767..12262020 234..487 100 <- Minus
arm_3R 12262083..12262315 1..233 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:51:34 Download gff for RE39106.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16176876..16177129 234..487 100 <- Minus
3R 16177192..16177424 1..233 100   Minus

RE39106.pep Sequence

Translation from 113 to 454

> RE39106.pep
MSHKYTELIKVGTQYARRMNYLSNRIFGEVARTTNEKSMKVVRMFSEEPI
HKRDYVINWYPRHVETHLLMKNLRDYGLFRDEHQDFKEEMKRLRKLRGKA
PPKKGEGKRASKK*

RE39106.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:09:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16517-PA 113 GF16517-PA 1..113 1..113 581 95.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:09:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19982-PA 113 GG19982-PA 1..113 1..113 592 98.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:09:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18246-PA 114 GH18246-PA 3..114 2..113 558 92 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:28
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS33-PA 113 CG10406-PA 1..113 1..113 598 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:09:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10201-PA 114 GI10201-PA 5..114 4..113 559 93.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:09:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22242-PA 113 GL22242-PA 1..113 1..113 586 97.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:09:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10300-PA 113 GA10300-PA 1..113 1..113 586 97.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:09:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15434-PA 113 GM15434-PA 1..113 1..113 592 98.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:09:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20290-PA 113 GD20290-PA 1..113 1..113 592 98.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:09:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23489-PA 113 GJ23489-PA 1..113 1..113 572 93.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:09:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14068-PA 114 GK14068-PA 3..114 2..113 571 94.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:09:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26314-PA 113 GE26314-PA 1..113 1..113 592 98.2 Plus

RE39106.hyp Sequence

Translation from 113 to 454

> RE39106.hyp
MSHKYTELIKVGTQYARRMNYLSNRIFGEVARTTNEKSMKVVRMFSEEPI
HKRDYVINWYPRHVETHLLMKNLRDYGLFRDEHQDFKEEMKRLRKLRGKA
PPKKGEGKRASKK*

RE39106.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:13:11
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS33-PA 113 CG10406-PA 1..113 1..113 598 100 Plus