BDGP Sequence Production Resources |
Search the DGRC for RE39106
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 391 |
Well: | 6 |
Vector: | pFlc-1 |
Associated Gene/Transcript | mRpS33-RA |
Protein status: | RE39106.pep: gold |
Preliminary Size: | 342 |
Sequenced Size: | 502 |
Gene | Date | Evidence |
---|---|---|
CG10406 | 2002-01-01 | Sim4 clustering to Release 2 |
CG10406 | 2003-01-01 | Sim4 clustering to Release 3 |
CG10406 | 2004-10-25 | Blastp of sequenced clone |
mRpS33 | 2008-04-29 | Release 5.5 accounting |
mRpS33 | 2008-08-15 | Release 5.9 accounting |
mRpS33 | 2008-12-18 | 5.12 accounting |
502 bp (502 high quality bases) assembled on 2006-06-05
GenBank Submission: BT016004
> RE39106.complete ACTTGGAAATCAGCTGTCGCTTGTTTTTGTTTCGTGACATAACCGCAATT TACTAAAACTTAGAAACTTAACTTAAATTATTTCATGAAAAGCATAGCAA ACTAATATTAACTATGTCCCACAAGTACACGGAGCTGATTAAGGTCGGCA CGCAGTATGCTCGCCGGATGAACTACCTCTCAAATCGCATTTTCGGCGAA GTGGCTCGCACCACAAACGAGAAGTCCATGAAGGTGGTTCGCATGTTCTC GGAGGAACCAATTCACAAACGGGACTACGTGATCAACTGGTATCCGCGGC ACGTGGAGACGCACTTGCTGATGAAGAACCTTCGCGACTACGGACTGTTC CGCGATGAGCACCAGGACTTCAAGGAGGAGATGAAGCGTCTGCGCAAGCT GCGCGGCAAGGCGCCTCCCAAGAAGGGCGAGGGCAAGCGGGCCTCAAAGA AGTAGTAAAATAAATATTCTAACATCCACTTTTATTGAAAAAAAAAAAAA AA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
HeT-A | 6083 | HeT-A DM06920 6083bp Derived from U06920.2 (Rel. 67, Last updated, Version 14). | 5779..5826 | 117..70 | 114 | 70.8 | Minus |
TAHRE | 10463 | TAHRE OSV 10463bp | 5688..5782 | 34..133 | 110 | 61.4 | Plus |
I-element | 5371 | I-element DMIFACA 5371bp Derived from M14954 (g157749) (Rel. 44, Last updated, Version 2). | 1783..1827 | 36..80 | 108 | 71.1 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 12260735..12260988 | 234..487 | 100 | <- | Minus |
chr3R | 12261051..12261283 | 1..233 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS33-RA | 1..342 | 114..455 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS33-RA | 1..342 | 114..455 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS33-RA | 1..342 | 114..455 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS33-RA | 1..342 | 114..455 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS33-RA | 1..342 | 114..455 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS33-RA | 1..487 | 1..487 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS33-RA | 1..487 | 1..487 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS33-RA | 5..491 | 1..487 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS33-RA | 1..487 | 1..487 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS33-RA | 5..491 | 1..487 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 16436045..16436298 | 234..487 | 100 | <- | Minus |
3R | 16436361..16436593 | 1..233 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 16436045..16436298 | 234..487 | 100 | <- | Minus |
3R | 16436361..16436593 | 1..233 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 16436045..16436298 | 234..487 | 100 | <- | Minus |
3R | 16436361..16436593 | 1..233 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 12261767..12262020 | 234..487 | 100 | <- | Minus |
arm_3R | 12262083..12262315 | 1..233 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 16176876..16177129 | 234..487 | 100 | <- | Minus |
3R | 16177192..16177424 | 1..233 | 100 | Minus |
Translation from 113 to 454
> RE39106.pep MSHKYTELIKVGTQYARRMNYLSNRIFGEVARTTNEKSMKVVRMFSEEPI HKRDYVINWYPRHVETHLLMKNLRDYGLFRDEHQDFKEEMKRLRKLRGKA PPKKGEGKRASKK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16517-PA | 113 | GF16517-PA | 1..113 | 1..113 | 581 | 95.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG19982-PA | 113 | GG19982-PA | 1..113 | 1..113 | 592 | 98.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18246-PA | 114 | GH18246-PA | 3..114 | 2..113 | 558 | 92 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpS33-PA | 113 | CG10406-PA | 1..113 | 1..113 | 598 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10201-PA | 114 | GI10201-PA | 5..114 | 4..113 | 559 | 93.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL22242-PA | 113 | GL22242-PA | 1..113 | 1..113 | 586 | 97.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA10300-PA | 113 | GA10300-PA | 1..113 | 1..113 | 586 | 97.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15434-PA | 113 | GM15434-PA | 1..113 | 1..113 | 592 | 98.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD20290-PA | 113 | GD20290-PA | 1..113 | 1..113 | 592 | 98.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23489-PA | 113 | GJ23489-PA | 1..113 | 1..113 | 572 | 93.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14068-PA | 114 | GK14068-PA | 3..114 | 2..113 | 571 | 94.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE26314-PA | 113 | GE26314-PA | 1..113 | 1..113 | 592 | 98.2 | Plus |
Translation from 113 to 454
> RE39106.hyp MSHKYTELIKVGTQYARRMNYLSNRIFGEVARTTNEKSMKVVRMFSEEPI HKRDYVINWYPRHVETHLLMKNLRDYGLFRDEHQDFKEEMKRLRKLRGKA PPKKGEGKRASKK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpS33-PA | 113 | CG10406-PA | 1..113 | 1..113 | 598 | 100 | Plus |