Clone RE39366 Report

Search the DGRC for RE39366

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:393
Well:66
Vector:pFlc-1
Associated Gene/TranscriptTsp29Fa-RA
Protein status:RE39366.pep: gold
Preliminary Size:794
Sequenced Size:979

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9494 2001-12-14 Blastp of sequenced clone
CG9494 2002-01-01 Sim4 clustering to Release 2
CG9494 2003-01-01 Sim4 clustering to Release 3
Tsp29Fa 2008-04-29 Release 5.5 accounting
Tsp29Fa 2008-08-15 Release 5.9 accounting
Tsp29Fa 2008-12-18 5.12 accounting

Clone Sequence Records

RE39366.complete Sequence

979 bp (979 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071356

> RE39366.complete
AGTTATTGTCCAACTGCCGTCAAGTTAAACTAAAATTGTCCACTTTCTGT
GTGCCCGCATAAACTAAAACAAACAAGATGTCGCTTCTAACGGGCAGCGC
CAATGCTGTGAAGTATACGCTTTTCGGATTTAACTTAATTTTTTTGATCA
CTGGCATTATCTTGATTGCCGTGGGAGCCGGAGTTGGCGCCGTCTATACG
GGCTATAAGCTCTTCCTGGCCGGAAAGTTCTTCTCGATCCCCACGTTCCT
GATCGTGATTGGATCGTTCATCATCATAATCTCTTTCTTTGGTTGCTGGG
GTGCCCTGAAGGAGAACTATTGCCTGGTGCTCAGCTTCTCGGTCATGCTG
GCCATCATCTTCATCCTGGAGCTGGCTGCTGGCATCAGTGGCTATGTGCT
GCGCAATGACGCCTCCGATTTGATCAAAACTTCTCTGACTTACTCGCTGA
ACGAGTATAACAGTATCAATCCAAATGCGACCACGAAACTCTGGGATGAC
ATCCAGGATGAGTTCGAGTGCTGTGGTGTGACCTCATACAACGACTGGAT
CACCGCCTTCCCTAACGGCGACCTGCCCATCTCCTGCTGCAACGTTCATG
TCGGCGCAGTGGGCACATTCACCTGCAATAATGCTCAGTCCAGCGTGGCA
GACCGGCACAAAGTTGGATGCCTCGACGGATTCTCCGGATACATTTCCGC
CCATGCGGTCAGCCTAGGAGCTGCAGGGGTGGTCATTGCCATCCTCCAGT
TCTTTGGCGTAATCTTTGCCTGCTACATTGCACGTGAGATTAAAATCCGT
AATGGAATTACTGGTTTTATGTAGGTCCGGAGGAAATCGATTCTGTAGGA
TGAGATGAGCTAGATAAGAATGGTGCCGATATTTACTTTAAATTCAATGA
TGTTCTTGGACATATACTGACATTTACCCTTGCTTGTAAAAATAAATAAA
TATATTTCTAAACAAAAAAAAAAAAAAAA

RE39366.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:47:09
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp29Fa-RA 1045 Tsp29Fa-RA 76..1044 1..969 4845 100 Plus
Tsp29Fa.b 981 Tsp29Fa.b 67..981 54..968 4575 100 Plus
Tsp29Fa.a 1035 Tsp29Fa.a 121..1034 56..969 4570 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:12:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8934068..8934671 146..749 3020 100 Plus
chr2L 23010047 chr2L 8934795..8935013 745..963 1095 100 Plus
chr2L 23010047 chr2L 8933885..8933975 56..146 455 100 Plus
chr2L 23010047 chr2L 8932881..8932935 1..55 275 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:54:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:12:02
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8935151..8935754 146..749 3020 100 Plus
2L 23513712 2L 8935878..8936102 745..969 1125 100 Plus
2L 23513712 2L 8934968..8935058 56..146 455 100 Plus
2L 23513712 2L 8933964..8934018 1..55 275 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:13:33
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8935151..8935754 146..749 3020 100 Plus
2L 23513712 2L 8935878..8936102 745..969 1125 100 Plus
2L 23513712 2L 8934968..8935058 56..146 455 100 Plus
2L 23513712 2L 8933964..8934018 1..55 275 100 Plus
Blast to na_te.dros performed 2019-03-16 19:12:02
Subject Length Description Subject Range Query Range Score Percent Strand
mariner2 912 mariner2 MARINER2 912bp 815..855 919..960 117 78.6 Plus

RE39366.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:13:09 Download gff for RE39366.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8932881..8932935 1..55 100 -> Plus
chr2L 8933885..8933975 56..146 100 -> Plus
chr2L 8934069..8934671 147..749 100 -> Plus
chr2L 8934800..8934982 750..932 100 <- Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:14:30 Download gff for RE39366.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp29Fa-RB 1..747 78..824 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:14:58 Download gff for RE39366.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp29Fa-RB 1..747 78..824 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:24:21 Download gff for RE39366.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp29Fa-RA 1..747 78..824 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:40:09 Download gff for RE39366.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp29Fa-RA 1..747 78..824 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:02:22 Download gff for RE39366.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp29Fa-RA 1..747 78..824 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:46:39 Download gff for RE39366.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp29Fa-RA 1..963 1..963 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:14:58 Download gff for RE39366.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp29Fa-RA 1..963 1..963 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:24:21 Download gff for RE39366.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp29Fa-RA 1..963 1..963 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:40:09 Download gff for RE39366.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp29Fa-RA 1..963 1..963 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:02:22 Download gff for RE39366.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp29Fa-RA 1..963 1..963 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:13:09 Download gff for RE39366.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8933964..8934018 1..55 100 -> Plus
2L 8934968..8935058 56..146 100 -> Plus
2L 8935152..8935754 147..749 100 -> Plus
2L 8935883..8936096 750..963 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:13:09 Download gff for RE39366.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8933964..8934018 1..55 100 -> Plus
2L 8934968..8935058 56..146 100 -> Plus
2L 8935152..8935754 147..749 100 -> Plus
2L 8935883..8936096 750..963 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:13:09 Download gff for RE39366.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8933964..8934018 1..55 100 -> Plus
2L 8934968..8935058 56..146 100 -> Plus
2L 8935152..8935754 147..749 100 -> Plus
2L 8935883..8936096 750..963 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:24:21 Download gff for RE39366.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8933964..8934018 1..55 100 -> Plus
arm_2L 8934968..8935058 56..146 100 -> Plus
arm_2L 8935152..8935754 147..749 100 -> Plus
arm_2L 8935883..8936096 750..963 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:16:58 Download gff for RE39366.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8935152..8935754 147..749 100 -> Plus
2L 8935883..8936096 750..963 100   Plus
2L 8933964..8934018 1..55 100 -> Plus
2L 8934968..8935058 56..146 100 -> Plus

RE39366.hyp Sequence

Translation from 77 to 823

> RE39366.hyp
MSLLTGSANAVKYTLFGFNLIFLITGIILIAVGAGVGAVYTGYKLFLAGK
FFSIPTFLIVIGSFIIIISFFGCWGALKENYCLVLSFSVMLAIIFILELA
AGISGYVLRNDASDLIKTSLTYSLNEYNSINPNATTKLWDDIQDEFECCG
VTSYNDWITAFPNGDLPISCCNVHVGAVGTFTCNNAQSSVADRHKVGCLD
GFSGYISAHAVSLGAAGVVIAILQFFGVIFACYIAREIKIRNGITGFM*

RE39366.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:30:58
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp29Fa-PC 248 CG9494-PC 1..248 1..248 1286 100 Plus
Tsp29Fa-PB 248 CG9494-PB 1..248 1..248 1286 100 Plus
Tsp29Fa-PA 248 CG9494-PA 1..248 1..248 1286 100 Plus
Tsp47F-PB 239 CG9033-PB 9..234 11..239 400 37.4 Plus
Tsp39D-PB 235 CG8666-PB 1..229 3..239 352 29.5 Plus

RE39366.pep Sequence

Translation from 77 to 823

> RE39366.pep
MSLLTGSANAVKYTLFGFNLIFLITGIILIAVGAGVGAVYTGYKLFLAGK
FFSIPTFLIVIGSFIIIISFFGCWGALKENYCLVLSFSVMLAIIFILELA
AGISGYVLRNDASDLIKTSLTYSLNEYNSINPNATTKLWDDIQDEFECCG
VTSYNDWITAFPNGDLPISCCNVHVGAVGTFTCNNAQSSVADRHKVGCLD
GFSGYISAHAVSLGAAGVVIAILQFFGVIFACYIAREIKIRNGITGFM*

RE39366.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:26:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15553-PA 248 GF15553-PA 1..248 1..248 1021 80.6 Plus
Dana\GF12397-PA 239 GF12397-PA 9..234 11..239 378 36.5 Plus
Dana\GF14328-PA 235 GF14328-PA 3..229 5..239 328 29.8 Plus
Dana\GF25226-PA 236 GF25226-PA 14..236 11..239 277 29.6 Plus
Dana\GF15554-PA 306 GF15554-PA 8..252 4..244 272 27.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:26:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25314-PA 248 GG25314-PA 1..248 1..248 1112 86.7 Plus
Dere\GG22652-PA 239 GG22652-PA 9..234 11..239 381 37.4 Plus
Dere\GG21299-PA 235 GG21299-PA 3..229 5..239 337 29.4 Plus
Dere\GG15769-PA 236 GG15769-PA 14..236 11..239 280 30 Plus
Dere\GG25316-PA 311 GG25316-PA 8..252 4..244 274 28.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:26:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13873-PA 247 GH13873-PA 1..247 1..248 922 73.4 Plus
Dgri\GH20509-PA 240 GH20509-PA 9..234 11..239 390 36.5 Plus
Dgri\GH13315-PA 235 GH13315-PA 3..229 5..239 368 32.3 Plus
Dgri\GH13874-PA 310 GH13874-PA 8..253 4..244 280 27.4 Plus
Dgri\GH14575-PA 236 GH14575-PA 14..236 11..239 277 30 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:01
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp29Fa-PC 248 CG9494-PC 1..248 1..248 1286 100 Plus
Tsp29Fa-PB 248 CG9494-PB 1..248 1..248 1286 100 Plus
Tsp29Fa-PA 248 CG9494-PA 1..248 1..248 1286 100 Plus
Tsp47F-PB 239 CG9033-PB 9..234 11..239 400 37.4 Plus
Tsp39D-PB 235 CG8666-PB 1..229 3..239 352 29.5 Plus
Tsp74F-PB 236 CG5492-PB 14..236 11..239 289 29.6 Plus
Tsp74F-PA 236 CG5492-PA 14..236 11..239 289 29.6 Plus
Tsp29Fb-PC 308 CG9496-PC 8..252 4..244 281 27.9 Plus
Tsp29Fb-PA 308 CG9496-PA 8..252 4..244 281 27.9 Plus
Tsp29Fb-PB 308 CG9496-PB 8..252 4..244 281 27.9 Plus
Tsp42Ea-PC 226 CG18817-PC 8..218 11..239 267 30.9 Plus
Tsp42Ea-PB 226 CG18817-PB 8..218 11..239 267 30.9 Plus
Tsp42Ea-PA 226 CG18817-PA 8..218 11..239 267 30.9 Plus
Tsp5D-PB 283 CG4690-PB 9..257 11..239 231 25.8 Plus
Tsp5D-PA 283 CG4690-PA 9..257 11..239 231 25.8 Plus
Tsp5D-PC 287 CG4690-PC 9..257 11..239 231 25.8 Plus
Tsp42Ed-PB 227 CG12846-PB 8..219 11..239 223 25.9 Plus
Tsp42Ed-PA 227 CG12846-PA 8..219 11..239 223 25.9 Plus
Tsp66E-PC 267 CG4999-PC 11..253 12..225 219 27.5 Plus
Tsp66E-PA 267 CG4999-PA 11..253 12..225 219 27.5 Plus
Tsp66E-PB 267 CG4999-PB 11..253 12..225 219 27.5 Plus
CG30160-PA 222 CG30160-PA 9..222 12..241 217 28.1 Plus
Tsp42Eb-PB 222 CG18816-PB 9..222 12..241 217 28.1 Plus
Tsp42Ee-PB 228 CG10106-PB 8..220 11..239 212 26.5 Plus
Tsp42Ee-PA 228 CG10106-PA 8..220 11..239 212 26.5 Plus
Tsp96F-PC 268 CG6120-PC 3..254 4..231 196 22.5 Plus
Tsp96F-PA 268 CG6120-PA 3..254 4..231 196 22.5 Plus
Tsp96F-PB 284 CG6120-PB 3..254 4..231 196 22.5 Plus
Tsp26A-PD 275 CG9093-PD 19..267 11..238 194 24.3 Plus
Tsp86D-PB 291 CG4591-PB 28..286 8..241 188 24.9 Plus
Tsp86D-PA 291 CG4591-PA 28..286 8..241 188 24.9 Plus
Tsp86D-PC 316 CG4591-PC 28..286 8..241 188 24.9 Plus
Tsp42Ec-PA 232 CG12847-PA 1..160 1..171 184 27.8 Plus
Tsp3A-PB 304 CG10742-PB 40..298 8..241 183 23.8 Plus
Tsp3A-PA 304 CG10742-PA 40..298 8..241 183 23.8 Plus
Tsp26A-PB 314 CG9093-PB 19..253 11..224 175 24.1 Plus
Tsp26A-PC 277 CG9093-PC 19..269 11..238 167 22.2 Plus
Tsp42El-PA 217 CG12840-PA 4..152 7..171 166 29.6 Plus
TM4SF-PA 286 CG11303-PA 11..224 12..234 148 22.3 Plus
TM4SF-PC 292 CG11303-PC 11..224 12..234 148 22.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:26:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17425-PA 248 GI17425-PA 1..248 1..248 906 70.6 Plus
Dmoj\GI21055-PA 240 GI21055-PA 9..234 11..239 383 36.1 Plus
Dmoj\GI12231-PA 235 GI12231-PA 3..229 5..239 357 33.3 Plus
Dmoj\GI17426-PA 308 GI17426-PA 8..251 4..244 277 27.9 Plus
Dmoj\GI13972-PA 236 GI13972-PA 14..236 11..239 275 30 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:26:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25578-PA 248 GL25578-PA 1..248 1..248 1035 79.8 Plus
Dper\GL10398-PA 239 GL10398-PA 9..234 11..239 375 35.7 Plus
Dper\GL26662-PA 235 GL26662-PA 3..229 5..239 331 28.9 Plus
Dper\GL22737-PA 236 GL22737-PA 14..236 11..239 277 29.6 Plus
Dper\GL25579-PA 308 GL25579-PA 8..252 4..244 277 27.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:26:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21830-PA 248 GA21830-PA 1..248 1..248 1032 79.4 Plus
Dpse\GA21493-PA 239 GA21493-PA 9..234 11..239 378 35.7 Plus
Dpse\GA21246-PA 235 GA21246-PA 3..229 5..239 321 28.5 Plus
Dpse\GA18924-PA 236 GA18924-PA 14..236 11..239 277 29.6 Plus
Dpse\GA21832-PA 308 GA21832-PA 8..252 4..244 276 27.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:26:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17261-PA 248 GM17261-PA 1..248 1..248 1214 94.8 Plus
Dsec\GM20434-PA 225 GM20434-PA 8..220 24..239 333 35.5 Plus
Dsec\GM23410-PA 235 GM23410-PA 3..229 5..239 329 29.8 Plus
Dsec\GM24293-PA 236 GM24293-PA 14..236 11..239 277 29.6 Plus
Dsec\GM17272-PA 308 GM17272-PA 8..252 4..244 263 27.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:26:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23574-PA 1578 GD23574-PA 1354..1578 24..248 1147 92.9 Plus
Dsim\GD25905-PA 246 GD25905-PA 9..241 11..239 358 35.4 Plus
Dsim\GD24319-PA 235 GD24319-PA 3..229 5..239 332 30.2 Plus
Dsim\GD12362-PA 236 GD12362-PA 14..236 11..239 277 29.6 Plus
Dsim\GD23575-PA 308 GD23575-PA 8..252 4..244 270 27.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:26:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18360-PA 248 GJ18360-PA 1..248 1..248 949 74.2 Plus
Dvir\GJ21977-PA 240 GJ21977-PA 9..234 11..239 384 36.1 Plus
Dvir\GJ17850-PA 235 GJ17850-PA 3..229 5..239 344 31.1 Plus
Dvir\GJ18361-PA 310 GJ18361-PA 8..253 4..244 284 27.8 Plus
Dvir\GJ14111-PA 236 GJ14111-PA 14..236 11..239 280 29.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:26:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24538-PA 248 GK24538-PA 1..247 1..247 1041 81.4 Plus
Dwil\GK21888-PA 239 GK21888-PA 9..234 11..239 394 37.4 Plus
Dwil\GK18739-PA 235 GK18739-PA 3..229 5..239 353 32.4 Plus
Dwil\GK20576-PA 236 GK20576-PA 14..236 11..239 276 30 Plus
Dwil\GK24539-PA 308 GK24539-PA 8..252 4..244 274 28.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:26:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18806-PA 248 GE18806-PA 1..248 1..248 1158 90.3 Plus
Dyak\GE13526-PA 239 GE13526-PA 9..234 11..239 381 37 Plus
Dyak\GE12914-PA 235 GE12914-PA 3..229 5..239 334 30.2 Plus
Dyak\GE22102-PA 236 GE22102-PA 14..236 11..239 277 29.6 Plus
Dyak\GE18807-PA 308 GE18807-PA 8..252 4..244 255 26.7 Plus