Clone RE39515 Report

Search the DGRC for RE39515

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:395
Well:15
Vector:pFlc-1
Associated Gene/TranscriptCG31142-RA
Protein status:RE39515.pep: gold
Sequenced Size:652

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31142 2001-12-14 Blastp of sequenced clone
CG13599 2002-01-01 Sim4 clustering to Release 2
CG31142 2003-01-01 Sim4 clustering to Release 3
CG31142 2008-04-29 Release 5.5 accounting
CG31142 2008-08-15 Release 5.9 accounting
CG31142 2008-12-18 5.12 accounting

Clone Sequence Records

RE39515.complete Sequence

652 bp (652 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071360

> RE39515.complete
GTTACTAAAACGCTGGTTTTGTTTGTTATTAAATCTTTACCTCTGCATGC
TTTAATATTCTTCCTAAAAAATAATGTCGGCACTTGGGGATTCTGATGAT
GAAACTGAGTTTAAAGAGATCAGCTCGACTAATTATCATCGTGTGCAGGA
AAAGGTGGCAAAGATAAGCTATGCAGATGGCGTTGCCGATGGCAGGGAAA
AGGTCTTCCAAGAGAGCTTCGATGAAGGCTTTGAGAATGGCTTTAAAACT
GGATTCGAACTGGCCAAACTGAGTGCCTTCTATGAAACCATAAGCAATGC
GGCGGGAGCTGAAAGCTCCGAATGGAATGCAGAACGAGAAGCTTATCAAA
AACTCCAACTGGCAGATGCAACAAATAAAGCACACTTCACATATTTGGAG
CATCAAGGCGCTCCACTCAACGTTATATCCGAAAAACAAAAGACCTACGT
GGACGACCTCCTAGGAAAACTGGCACAGCAACTCCCGGCAACTACGAATT
TATTCACATCGGGGAGCGATTCTAGTGTTAATGTGGTTTAATGCATGTGT
TTGGGAATTATCAAAATTAACTTGAAAGTATATCTTCGCGCGACTTATAA
ATAAAGACCCTCGGGCGTGCCCTCCTTCTTCCGGTACAAAAAAAAAAAAA
AA

RE39515.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:45:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG31142-RA 762 CG31142-RA 79..717 1..639 3195 100 Plus
Pros26_4-RA 1654 Pros26_4-RA 1491..1654 639..476 820 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:11:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 19752959..19753435 161..637 2370 99.8 Plus
chr3R 27901430 chr3R 19752697..19752859 1..163 800 99.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:54:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:11:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23929512..23929990 161..639 2395 100 Plus
3R 32079331 3R 23929250..23929417 1..168 825 99.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:12:03
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23670343..23670821 161..639 2395 100 Plus
3R 31820162 3R 23670081..23670248 1..168 825 99.4 Plus
Blast to na_te.dros performed on 2019-03-16 21:11:25 has no hits.

RE39515.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:12:40 Download gff for RE39515.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 19752697..19752859 1..163 99 -> Plus
chr3R 19752962..19753435 164..637 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:14:36 Download gff for RE39515.complete
Subject Subject Range Query Range Percent Splice Strand
CG31142-RA 1..468 74..541 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:12:32 Download gff for RE39515.complete
Subject Subject Range Query Range Percent Splice Strand
CG31142-RA 1..468 74..541 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:34:58 Download gff for RE39515.complete
Subject Subject Range Query Range Percent Splice Strand
CG31142-RA 1..468 74..541 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:36:42 Download gff for RE39515.complete
Subject Subject Range Query Range Percent Splice Strand
CG31142-RA 1..468 74..541 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:10:03 Download gff for RE39515.complete
Subject Subject Range Query Range Percent Splice Strand
CG31142-RA 1..468 74..541 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:43:14 Download gff for RE39515.complete
Subject Subject Range Query Range Percent Splice Strand
CG31142-RA 1..637 1..637 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:12:32 Download gff for RE39515.complete
Subject Subject Range Query Range Percent Splice Strand
CG31142-RA 22..658 1..637 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:34:58 Download gff for RE39515.complete
Subject Subject Range Query Range Percent Splice Strand
CG31142-RA 8..644 1..637 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:36:43 Download gff for RE39515.complete
Subject Subject Range Query Range Percent Splice Strand
CG31142-RA 1..637 1..637 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:10:03 Download gff for RE39515.complete
Subject Subject Range Query Range Percent Splice Strand
CG31142-RA 8..644 1..637 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:12:40 Download gff for RE39515.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23929250..23929412 1..163 100 -> Plus
3R 23929515..23929988 164..637 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:12:40 Download gff for RE39515.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23929250..23929412 1..163 100 -> Plus
3R 23929515..23929988 164..637 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:12:40 Download gff for RE39515.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23929250..23929412 1..163 100 -> Plus
3R 23929515..23929988 164..637 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:34:58 Download gff for RE39515.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19754972..19755134 1..163 100 -> Plus
arm_3R 19755237..19755710 164..637 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:14:13 Download gff for RE39515.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23670346..23670819 164..637 100   Plus
3R 23670081..23670243 1..163 100 -> Plus

RE39515.hyp Sequence

Translation from 73 to 540

> RE39515.hyp
MSALGDSDDETEFKEISSTNYHRVQEKVAKISYADGVADGREKVFQESFD
EGFENGFKTGFELAKLSAFYETISNAAGAESSEWNAEREAYQKLQLADAT
NKAHFTYLEHQGAPLNVISEKQKTYVDDLLGKLAQQLPATTNLFTSGSDS
SVNVV*

RE39515.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:32:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG31142-PA 155 CG31142-PA 1..155 1..155 786 100 Plus

RE39515.pep Sequence

Translation from 73 to 540

> RE39515.pep
MSALGDSDDETEFKEISSTNYHRVQEKVAKISYADGVADGREKVFQESFD
EGFENGFKTGFELAKLSAFYETISNAAGAESSEWNAEREAYQKLQLADAT
NKAHFTYLEHQGAPLNVISEKQKTYVDDLLGKLAQQLPATTNLFTSGSDS
SVNVV*

RE39515.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:18:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17977-PA 150 GF17977-PA 1..150 1..155 437 56.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:18:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11236-PA 154 GG11236-PA 1..154 1..155 738 91 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:18:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21163-PA 147 GH21163-PA 1..144 1..146 406 52 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:53:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG31142-PA 155 CG31142-PA 1..155 1..155 786 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:18:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10479-PA 147 GI10479-PA 1..144 1..146 404 52.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:18:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23379-PA 153 GL23379-PA 1..153 1..155 433 55.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:18:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16042-PA 153 GA16042-PA 1..153 1..155 446 56.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:18:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26537-PA 155 GM26537-PA 1..155 1..155 744 92.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:18:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21045-PA 155 GD21045-PA 1..155 1..155 766 94.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:18:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23160-PA 147 GJ23160-PA 1..144 1..146 410 52.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:18:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11141-PA 143 GK11141-PA 1..142 1..146 416 54.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:18:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10403-PA 154 GE10403-PA 1..154 1..155 710 88.4 Plus