BDGP Sequence Production Resources |
Search the DGRC for RE39515
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 395 |
Well: | 15 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG31142-RA |
Protein status: | RE39515.pep: gold |
Sequenced Size: | 652 |
Gene | Date | Evidence |
---|---|---|
CG31142 | 2001-12-14 | Blastp of sequenced clone |
CG13599 | 2002-01-01 | Sim4 clustering to Release 2 |
CG31142 | 2003-01-01 | Sim4 clustering to Release 3 |
CG31142 | 2008-04-29 | Release 5.5 accounting |
CG31142 | 2008-08-15 | Release 5.9 accounting |
CG31142 | 2008-12-18 | 5.12 accounting |
652 bp (652 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071360
> RE39515.complete GTTACTAAAACGCTGGTTTTGTTTGTTATTAAATCTTTACCTCTGCATGC TTTAATATTCTTCCTAAAAAATAATGTCGGCACTTGGGGATTCTGATGAT GAAACTGAGTTTAAAGAGATCAGCTCGACTAATTATCATCGTGTGCAGGA AAAGGTGGCAAAGATAAGCTATGCAGATGGCGTTGCCGATGGCAGGGAAA AGGTCTTCCAAGAGAGCTTCGATGAAGGCTTTGAGAATGGCTTTAAAACT GGATTCGAACTGGCCAAACTGAGTGCCTTCTATGAAACCATAAGCAATGC GGCGGGAGCTGAAAGCTCCGAATGGAATGCAGAACGAGAAGCTTATCAAA AACTCCAACTGGCAGATGCAACAAATAAAGCACACTTCACATATTTGGAG CATCAAGGCGCTCCACTCAACGTTATATCCGAAAAACAAAAGACCTACGT GGACGACCTCCTAGGAAAACTGGCACAGCAACTCCCGGCAACTACGAATT TATTCACATCGGGGAGCGATTCTAGTGTTAATGTGGTTTAATGCATGTGT TTGGGAATTATCAAAATTAACTTGAAAGTATATCTTCGCGCGACTTATAA ATAAAGACCCTCGGGCGTGCCCTCCTTCTTCCGGTACAAAAAAAAAAAAA AA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 19752697..19752859 | 1..163 | 99 | -> | Plus |
chr3R | 19752962..19753435 | 164..637 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31142-RA | 1..468 | 74..541 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31142-RA | 1..468 | 74..541 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31142-RA | 1..468 | 74..541 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31142-RA | 1..468 | 74..541 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31142-RA | 1..468 | 74..541 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31142-RA | 1..637 | 1..637 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31142-RA | 22..658 | 1..637 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31142-RA | 8..644 | 1..637 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31142-RA | 1..637 | 1..637 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31142-RA | 8..644 | 1..637 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 23929250..23929412 | 1..163 | 100 | -> | Plus |
3R | 23929515..23929988 | 164..637 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 23929250..23929412 | 1..163 | 100 | -> | Plus |
3R | 23929515..23929988 | 164..637 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 23929250..23929412 | 1..163 | 100 | -> | Plus |
3R | 23929515..23929988 | 164..637 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 19754972..19755134 | 1..163 | 100 | -> | Plus |
arm_3R | 19755237..19755710 | 164..637 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 23670346..23670819 | 164..637 | 100 | Plus | |
3R | 23670081..23670243 | 1..163 | 100 | -> | Plus |
Translation from 73 to 540
> RE39515.hyp MSALGDSDDETEFKEISSTNYHRVQEKVAKISYADGVADGREKVFQESFD EGFENGFKTGFELAKLSAFYETISNAAGAESSEWNAEREAYQKLQLADAT NKAHFTYLEHQGAPLNVISEKQKTYVDDLLGKLAQQLPATTNLFTSGSDS SVNVV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG31142-PA | 155 | CG31142-PA | 1..155 | 1..155 | 786 | 100 | Plus |
Translation from 73 to 540
> RE39515.pep MSALGDSDDETEFKEISSTNYHRVQEKVAKISYADGVADGREKVFQESFD EGFENGFKTGFELAKLSAFYETISNAAGAESSEWNAEREAYQKLQLADAT NKAHFTYLEHQGAPLNVISEKQKTYVDDLLGKLAQQLPATTNLFTSGSDS SVNVV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF17977-PA | 150 | GF17977-PA | 1..150 | 1..155 | 437 | 56.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11236-PA | 154 | GG11236-PA | 1..154 | 1..155 | 738 | 91 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21163-PA | 147 | GH21163-PA | 1..144 | 1..146 | 406 | 52 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG31142-PA | 155 | CG31142-PA | 1..155 | 1..155 | 786 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10479-PA | 147 | GI10479-PA | 1..144 | 1..146 | 404 | 52.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL23379-PA | 153 | GL23379-PA | 1..153 | 1..155 | 433 | 55.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA16042-PA | 153 | GA16042-PA | 1..153 | 1..155 | 446 | 56.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM26537-PA | 155 | GM26537-PA | 1..155 | 1..155 | 744 | 92.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD21045-PA | 155 | GD21045-PA | 1..155 | 1..155 | 766 | 94.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23160-PA | 147 | GJ23160-PA | 1..144 | 1..146 | 410 | 52.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11141-PA | 143 | GK11141-PA | 1..142 | 1..146 | 416 | 54.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE10403-PA | 154 | GE10403-PA | 1..154 | 1..155 | 710 | 88.4 | Plus |