Clone RE39562 Report

Search the DGRC for RE39562

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:395
Well:62
Vector:pFlc-1
Associated Gene/TranscriptPex11-RA
Protein status:RE39562.pep: gold
Preliminary Size:726
Sequenced Size:948

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8315 2001-12-14 Blastp of sequenced clone
CG8315 2002-01-01 Sim4 clustering to Release 2
CG8315 2003-01-01 Sim4 clustering to Release 3
CG8315 2008-04-29 Release 5.5 accounting
CG8315 2008-08-15 Release 5.9 accounting
CG8315 2008-12-18 5.12 accounting

Clone Sequence Records

RE39562.complete Sequence

948 bp (948 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071362

> RE39562.complete
AATAATCGAACTTTGGATTTTGGATTTGGCATAATTTTGATTTTAGCTGT
CCAACGAGCTGTGCGGTCACAACATAAATATGGATCAACTGGTGCAGTTG
AACAATCAGGCTGGCGGACGGGACAAAATCGCCCGACTTATTCAGTATGC
CTCGCGTGCAATGTGGGACTCGCTGGAGTCCGCCAATTCCAATCCAGCGC
TTGTGGACAACTTCAAGACGGTTGAATACATCCTGAGCACATTCCGAAAA
TTACTCCGCTTTGGTAAGTGCGTTGATGTATTCTACGGCGCTCTGAAGAC
CATTCACCATCCGGATCTTAACATCCGTGTGACGCTCACCTTAAGCAAGC
TGTCACAATCGCTGTTCCTCTTCGCCGATCACTTCCTCTGGCTGGCCAGG
ACGGGACTGACGGCGGTGAACGCCAAGCGCTGGTCCAACATCGCCAATAA
GTACTGGCTCTTCTCGATCATAATGAACTTGTGCCGGGACTTCTACGAGA
TCCTGAGAGTACTGGACCTGCATCGATCCGGTAGCAAGAGCGGCATTTCG
CGCTGCCGCATCCCCGCGAGCATCAACTCGCCGGAGGACTTTAAGCGCCT
TGCCCTGCAGTCCTACGTGCTGATGCAGGGACACAAAGACATAGTTGTGG
ACACGGTGAAGAATGCGTGCGACTTCTTCATTCCGCTGACGGCTCTGGGT
TACACAAGTCTCACGCCCCGGACAATTGGACTCCTGGGGGCAATTTCATC
GCTGGCTGGACTCTGGGCTCTGCTGGAACCGAGGGCCAAGCTAACGCCTG
CATAACACCTGATATTGGAAACTTTGTAGATAAGGGCCTGTATTTCCTTG
TATCTATTTTAAGTGTTGTATGTATTGTATTTGTATTTGTGCTCGGATTA
AGCTGAATGATAAACAAACGATTTTATTAAACAAAAAAAAAAAAAAAA

RE39562.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:45:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG8315-RA 983 CG8315-RA 36..967 1..932 4660 100 Plus
CG8320.b 1012 CG8320.b 1..69 408..340 345 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:13:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 11878636..11879316 932..252 3405 100 Minus
chr2R 21145070 chr2R 11879370..11879620 251..1 1255 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:54:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:13:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15991367..15992047 932..252 3405 100 Minus
2R 25286936 2R 15992101..15992351 251..1 1255 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:11:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 15992566..15993246 932..252 3405 100 Minus
2R 25260384 2R 15993300..15993550 251..1 1255 100 Minus
Blast to na_te.dros performed 2019-03-15 14:13:02
Subject Length Description Subject Range Query Range Score Percent Strand
ZAM 8435 ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). 590..636 893..848 124 76.6 Minus

RE39562.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:14:24 Download gff for RE39562.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 11879370..11879620 1..251 100   Minus
chr2R 11878636..11879316 252..932 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:14:38 Download gff for RE39562.complete
Subject Subject Range Query Range Percent Splice Strand
CG8315-RA 1..726 80..805 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:12:17 Download gff for RE39562.complete
Subject Subject Range Query Range Percent Splice Strand
CG8315-RA 1..726 80..805 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:23:54 Download gff for RE39562.complete
Subject Subject Range Query Range Percent Splice Strand
Pex11-RA 1..726 80..805 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:36:30 Download gff for RE39562.complete
Subject Subject Range Query Range Percent Splice Strand
CG8315-RA 1..726 80..805 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:54:52 Download gff for RE39562.complete
Subject Subject Range Query Range Percent Splice Strand
Pex11-RA 1..726 80..805 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:42:53 Download gff for RE39562.complete
Subject Subject Range Query Range Percent Splice Strand
CG8315-RA 1..932 1..932 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:12:17 Download gff for RE39562.complete
Subject Subject Range Query Range Percent Splice Strand
CG8315-RA 1..932 1..932 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:23:54 Download gff for RE39562.complete
Subject Subject Range Query Range Percent Splice Strand
Pex11-RA 25..956 1..932 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:36:30 Download gff for RE39562.complete
Subject Subject Range Query Range Percent Splice Strand
CG8315-RA 1..932 1..932 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:54:52 Download gff for RE39562.complete
Subject Subject Range Query Range Percent Splice Strand
Pex11-RA 25..956 1..932 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:14:24 Download gff for RE39562.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15992101..15992351 1..251 100   Minus
2R 15991367..15992047 252..932 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:14:24 Download gff for RE39562.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15992101..15992351 1..251 100   Minus
2R 15991367..15992047 252..932 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:14:24 Download gff for RE39562.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15992101..15992351 1..251 100   Minus
2R 15991367..15992047 252..932 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:23:54 Download gff for RE39562.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11878872..11879552 252..932 100 <- Minus
arm_2R 11879606..11879856 1..251 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:13:56 Download gff for RE39562.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15992566..15993246 252..932 100 <- Minus
2R 15993300..15993550 1..251 100   Minus

RE39562.pep Sequence

Translation from 79 to 804

> RE39562.pep
MDQLVQLNNQAGGRDKIARLIQYASRAMWDSLESANSNPALVDNFKTVEY
ILSTFRKLLRFGKCVDVFYGALKTIHHPDLNIRVTLTLSKLSQSLFLFAD
HFLWLARTGLTAVNAKRWSNIANKYWLFSIIMNLCRDFYEILRVLDLHRS
GSKSGISRCRIPASINSPEDFKRLALQSYVLMQGHKDIVVDTVKNACDFF
IPLTALGYTSLTPRTIGLLGAISSLAGLWALLEPRAKLTPA*

RE39562.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:18:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13330-PA 243 GF13330-PA 3..242 1..240 1164 90.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:18:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22312-PA 241 GG22312-PA 1..241 1..241 1239 96.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:18:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19830-PA 241 GH19830-PA 1..241 1..241 1049 79.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:37
Subject Length Description Subject Range Query Range Score Percent Strand
Pex11-PA 241 CG8315-PA 1..241 1..241 1240 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:18:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20418-PA 241 GI20418-PA 1..241 1..241 1068 80.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:18:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20649-PA 241 GL20649-PA 1..241 1..241 1122 85.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:18:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20979-PA 241 GA20979-PA 1..241 1..241 1129 85.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:18:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20102-PA 277 GM20102-PA 1..230 1..230 1192 97 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:18:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25578-PA 243 GD25578-PA 3..243 1..241 1250 97.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:18:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20090-PA 214 GJ20090-PA 1..214 28..241 942 80.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:18:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22099-PA 241 GK22099-PA 1..241 1..241 1114 83.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:18:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14109-PA 243 GE14109-PA 3..243 1..241 1232 95.9 Plus

RE39562.hyp Sequence

Translation from 79 to 804

> RE39562.hyp
MDQLVQLNNQAGGRDKIARLIQYASRAMWDSLESANSNPALVDNFKTVEY
ILSTFRKLLRFGKCVDVFYGALKTIHHPDLNIRVTLTLSKLSQSLFLFAD
HFLWLARTGLTAVNAKRWSNIANKYWLFSIIMNLCRDFYEILRVLDLHRS
GSKSGISRCRIPASINSPEDFKRLALQSYVLMQGHKDIVVDTVKNACDFF
IPLTALGYTSLTPRTIGLLGAISSLAGLWALLEPRAKLTPA*

RE39562.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:56:12
Subject Length Description Subject Range Query Range Score Percent Strand
Pex11-PA 241 CG8315-PA 1..241 1..241 1240 100 Plus