Clone RE39606 Report

Search the DGRC for RE39606

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:396
Well:6
Vector:pFlc-1
Associated Gene/TranscriptRsf1-RA
Protein status:RE39606.pep: gold
Preliminary Size:1158
Sequenced Size:942

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5655 2001-12-14 Blastp of sequenced clone
CG5655 2002-01-01 Sim4 clustering to Release 2
Rsf1 2008-04-29 Release 5.5 accounting
Rsf1 2008-08-15 Release 5.9 accounting
Rsf1 2008-12-18 5.12 accounting

Clone Sequence Records

RE39606.complete Sequence

942 bp (942 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071363

> RE39606.complete
AACGAGTTTAACCACCCTGGTCGAAAAGTTGATATAGATACAAACGCTAA
ATTGTCCGGTGGTGATAACTTATTGATTATTTATTTTTCAAGGCAGCTAT
CCGATTTGCAGGATAACTCCGAAAACGAATCAGAAACAGTGAATCCAGAT
GTCCAGCATGGGTGATCAGCGCGGGACACGGGTGTATGTCGGCAATCTGA
CCGACAAAGTGAAAAAGGATGATCTGGAGGGGGAGTTCACAAAGTATGGC
AAGCTGAATTCGGTGTGGATAGCCTTCAATCCGCCGGGATTTGCGTTCGT
CGAGTTCGAGCACCGCGACGACGCCGAAAAGGCGTGCGACATACTGAACG
GATCCGAGCTGCTCGGCTCCCAGCTGCGCGTGGAGATCTCAAAAGGGCGG
CCACGCCAGGGTAGGCGTGGCGGACCCATGGACAGGGGCGGACGACGCGG
CGACTTTGGCCGGCACAGCATCACAAGCGGTGGTAGCGGCGGAGGCGGTT
TCCGGCAGCGCGGATCCAGCGGATCCTCAAGCCGGCACACGGAGCGGGGC
TATAGCTCCGGCCGATCAGGTGCAAGCAGCTATAATGGCAGAGAGGGCGG
CGGCAGCGGCTTCAATCGCCGCGAGGTTTACGGCGGTGGACGCGACAGCA
GCCGCTACAGCAGCGGAAGTAGCGCCAGCTACGGACGCACTGGTGGTCAG
TCGGCCGGACGCTTCAGGTCCCGCTCGCCGGTGGGAAACCATCGATTCTA
ATGACAACACCACTCATAGTTGCTTAAGGATTGCCTATGAGTAAAGATTA
ATAAATAATAACTTAAGCGCGACCGTAAAACGCAGACTCAAACATTTAAA
ATCGTAGCATTCGATCGTTTTCGATCGTCCAACAGATTCCCTCATTCCCC
CACATCAACAACAACAACAGAATGACAAAAAAAAAAAAAAAA

RE39606.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:44:38
Subject Length Description Subject Range Query Range Score Percent Strand
Rsf1-RA 1157 Rsf1-RA 17..958 1..942 4680 99.7 Plus
Rsf1.b 1732 Rsf1.b 70..900 112..942 4125 99.7 Plus
Rsf1.a 1244 Rsf1.a 70..900 112..942 4125 99.7 Plus
Rsf1.b 1732 Rsf1.b 17..70 1..54 270 100 Plus
Rsf1.a 1244 Rsf1.a 17..70 1..54 270 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:29:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10261498..10262422 925..1 4625 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:54:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:29:52
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10262625..10263566 942..1 4680 99.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:11:19
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10262625..10263566 942..1 4680 99.7 Minus
Blast to na_te.dros performed on 2019-03-16 03:29:52 has no hits.

RE39606.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:30:44 Download gff for RE39606.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10261497..10262422 1..926 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:14:39 Download gff for RE39606.complete
Subject Subject Range Query Range Percent Splice Strand
Rsf1-RA 1..603 149..751 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:11:19 Download gff for RE39606.complete
Subject Subject Range Query Range Percent Splice Strand
Rsf1-RA 1..603 149..751 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:46:05 Download gff for RE39606.complete
Subject Subject Range Query Range Percent Splice Strand
Rsf1-RA 1..603 149..751 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:35:34 Download gff for RE39606.complete
Subject Subject Range Query Range Percent Splice Strand
Rsf1-RA 1..603 149..751 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:07:30 Download gff for RE39606.complete
Subject Subject Range Query Range Percent Splice Strand
Rsf1-RA 1..603 149..751 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:41:33 Download gff for RE39606.complete
Subject Subject Range Query Range Percent Splice Strand
Rsf1-RA 17..941 1..926 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:11:19 Download gff for RE39606.complete
Subject Subject Range Query Range Percent Splice Strand
Rsf1-RA 17..941 1..926 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:46:05 Download gff for RE39606.complete
Subject Subject Range Query Range Percent Splice Strand
Rsf1-RA 1..913 13..926 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:35:34 Download gff for RE39606.complete
Subject Subject Range Query Range Percent Splice Strand
Rsf1-RA 17..941 1..926 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:07:30 Download gff for RE39606.complete
Subject Subject Range Query Range Percent Splice Strand
Rsf1-RA 1..913 13..926 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:30:44 Download gff for RE39606.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10262641..10263566 1..926 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:30:44 Download gff for RE39606.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10262641..10263566 1..926 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:30:44 Download gff for RE39606.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10262641..10263566 1..926 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:46:05 Download gff for RE39606.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10262641..10263566 1..926 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:12:51 Download gff for RE39606.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10262641..10263566 1..926 99   Minus

RE39606.pep Sequence

Translation from 148 to 750

> RE39606.pep
MSSMGDQRGTRVYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFNPPGFAF
VEFEHRDDAEKACDILNGSELLGSQLRVEISKGRPRQGRRGGPMDRGGRR
GDFGRHSITSGGSGGGGFRQRGSSGSSSRHTERGYSSGRSGASSYNGREG
GGSGFNRREVYGGGRDSSRYSSGSSASYGRTGGQSAGRFRSRSPVGNHRF
*

RE39606.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:15:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14123-PA 192 GF14123-PA 1..192 4..200 515 81.2 Plus
Dana\GF17902-PA 163 GF17902-PA 10..81 9..80 204 52.8 Plus
Dana\GF19500-PA 179 GF19500-PA 10..81 9..80 204 52.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:15:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23961-PA 200 GG23961-PA 1..200 1..200 993 99.5 Plus
Dere\GG17683-PA 144 GG17683-PA 10..81 9..80 209 54.2 Plus
Dere\GG19507-PA 159 GG19507-PA 10..81 9..80 197 52.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:15:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13017-PA 201 GH13017-PA 1..195 4..195 557 73.1 Plus
Dgri\GH24472-PA 163 GH24472-PA 10..81 9..80 197 52.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:27:29
Subject Length Description Subject Range Query Range Score Percent Strand
Rsf1-PB 200 CG5655-PB 1..200 1..200 1058 100 Plus
Rsf1-PA 200 CG5655-PA 1..200 1..200 1058 100 Plus
Rbp1-like-PC 158 CG1987-PC 12..157 11..148 286 44.5 Plus
Rbp1-like-PA 158 CG1987-PA 12..157 11..148 286 44.5 Plus
Rbp1-like-PB 247 CG1987-PB 12..144 11..181 280 43.3 Plus
x16-PA 258 CG10203-PA 9..182 11..188 266 40.2 Plus
Rbp1-PA 135 CG17136-PA 12..134 11..148 263 44.9 Plus
x16-PB 257 CG10203-PB 9..181 11..188 261 41.7 Plus
Rbp1-PD 144 CG17136-PD 12..123 11..136 258 46 Plus
SC35-PD 195 CG5442-PD 27..195 14..193 174 34 Plus
SC35-PC 195 CG5442-PC 27..195 14..193 174 34 Plus
SC35-PB 195 CG5442-PB 27..195 14..193 174 34 Plus
B52-PB 329 CG10851-PB 3..112 9..130 173 41.1 Plus
B52-PO 355 CG10851-PO 3..112 9..130 173 41.1 Plus
B52-PM 355 CG10851-PM 3..112 9..130 173 41.1 Plus
B52-PI 135 CG10851-PI 3..105 9..124 171 41 Plus
B52-PD 135 CG10851-PD 3..105 9..124 171 41 Plus
B52-PK 147 CG10851-PK 3..105 9..124 171 41 Plus
B52-PF 147 CG10851-PF 3..105 9..124 171 41 Plus
B52-PN 350 CG10851-PN 3..105 9..124 171 41 Plus
B52-PC 350 CG10851-PC 3..105 9..124 171 41 Plus
B52-PA 350 CG10851-PA 3..105 9..124 171 41 Plus
SF2-PB 255 CG6987-PB 1..221 4..193 165 30.2 Plus
SF2-PA 255 CG6987-PA 1..221 4..193 165 30.2 Plus
Hrb87F-PE 385 CG12749-PE 116..312 11..187 162 31.1 Plus
Hrb87F-PD 385 CG12749-PD 116..312 11..187 162 31.1 Plus
Hrb87F-PC 385 CG12749-PC 116..312 11..187 162 31.1 Plus
Hrb87F-PA 385 CG12749-PA 116..312 11..187 162 31.1 Plus
sqd-PB 344 CG16901-PB 134..333 8..187 158 27.6 Plus
eIF4H1-PC 358 CG4429-PC 32..206 13..187 156 34.7 Plus
eIF4H1-PD 388 CG4429-PD 32..206 13..187 156 34.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:15:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19446-PA 196 GI19446-PA 1..196 4..200 674 80.7 Plus
Dmoj\GI23736-PA 137 GI23736-PA 10..81 9..80 205 54.2 Plus
Dmoj\GI15337-PA 151 GI15337-PA 10..81 9..80 197 52.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:15:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18979-PA 196 GL18979-PA 1..196 1..200 764 84.6 Plus
Dper\GL26725-PA 174 GL26725-PA 10..81 9..80 196 52.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:15:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19037-PA 196 GA19037-PA 1..196 1..200 764 84.6 Plus
Dpse\GA30013-PA 259 GA30013-PA 9..82 11..84 205 54.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:15:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11879-PA 200 GM11879-PA 1..200 1..200 997 100 Plus
Dsec\GM23896-PA 144 GM23896-PA 10..81 9..80 209 54.2 Plus
Dsec\GM13734-PA 226 GM13734-PA 9..88 11..90 193 52.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:15:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22286-PA 200 GD22286-PA 1..200 1..200 997 100 Plus
Dsim\GD18708-PA 144 GD18708-PA 10..81 9..80 209 54.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:15:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17527-PA 198 GJ17527-PA 1..198 4..200 508 74.9 Plus
Dvir\GJ10582-PA 140 GJ10582-PA 11..87 10..86 222 55.8 Plus
Dvir\GJ14774-PA 155 GJ14774-PA 10..81 9..80 199 52.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:15:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12439-PA 192 GK12439-PA 1..192 4..200 551 69.7 Plus
Dwil\GK13897-PA 140 GK13897-PA 10..81 9..80 208 52.8 Plus
Dwil\GK16401-PA 176 GK16401-PA 10..81 9..80 201 52.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:15:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26241-PA 200 GE26241-PA 1..200 1..200 993 99.5 Plus
Dyak\GE26048-PA 135 GE26048-PA 10..81 9..80 208 54.2 Plus
Dyak\GE16161-PA 160 GE16161-PA 10..81 9..80 197 52.8 Plus

RE39606.hyp Sequence

Translation from 148 to 750

> RE39606.hyp
MSSMGDQRGTRVYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFNPPGFAF
VEFEHRDDAEKACDILNGSELLGSQLRVEISKGRPRQGRRGGPMDRGGRR
GDFGRHSITSGGSGGGGFRQRGSSGSSSRHTERGYSSGRSGASSYNGREG
GGSGFNRREVYGGGRDSSRYSSGSSASYGRTGGQSAGRFRSRSPVGNHRF
*

RE39606.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:47:38
Subject Length Description Subject Range Query Range Score Percent Strand
Rsf1-PB 200 CG5655-PB 1..200 1..200 1058 100 Plus
Rsf1-PA 200 CG5655-PA 1..200 1..200 1058 100 Plus
Rbp1-like-PC 158 CG1987-PC 12..157 11..148 286 44.5 Plus
Rbp1-like-PA 158 CG1987-PA 12..157 11..148 286 44.5 Plus
Rbp1-like-PB 247 CG1987-PB 12..144 11..181 280 43.3 Plus