Clone RE39629 Report

Search the DGRC for RE39629

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:396
Well:29
Vector:pFlc-1
Associated Gene/TranscriptCG7519-RA
Protein status:RE39629.pep: gold
Preliminary Size:602
Sequenced Size:718

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7519 2001-12-14 Blastp of sequenced clone
CG7519 2002-01-01 Sim4 clustering to Release 2
CG7519 2003-01-01 Sim4 clustering to Release 3
CG7519 2008-04-29 Release 5.5 accounting
CG7519 2008-08-15 Release 5.9 accounting
CG7519 2008-12-18 5.12 accounting

Clone Sequence Records

RE39629.complete Sequence

718 bp (718 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071364

> RE39629.complete
GACTTGCGGCTGGTCACACTGCGCTAAACAAAGTACGAAACGTGATTTTT
CGTTTCAATAATTTTTAAAGTAAATAAGCAACCTTGTCCAAATAAAATGG
AGATGATGCATGGAGCGTCGCTGCTGTCGCGGCCAGCGGAGGAATTTGGC
AACGACACCCTGGTGGAGGAAATGTGGGCCGCAAAAGCTCTGGAACACGC
CGAGGTGCACTTTAATCTCATCACCAGCGTCCATCCCTCCCAGCTGAAGC
TCACGCCCTACGACGACCAGATATACGCCACTTTCCGGCAGGATTTTCCC
GATCTTCACGTTGGCCGGCTTACCGATGATATTCTCAAATCCGCCACGGC
GAAGCTCAAGTGGCGCCAGTTCGCCGAGAAGTTTAACAAGTTGGACGATT
ACTCGTATGGCACCCTGATGCGCGCCGATGCCAGCAGGGAATTCTCCCCG
GACAACTCTATCTTCGTGTTTCGCGTCCAGTTTCTGGCAATCGAGATTGC
CCGGAATCGGGAGGGACTCAACGATGAGGCTTACGAGAAGCACAAGCCCG
CCAGAAAGGTACCCGAAGAGGAACAGTAATCCCTCGCTCTAGCTTAGATT
AAGTTGTAAAGACTGGATGCATATTTAGCTGCAGTTCGTCTATCTACTTT
AGTAAACAATCAAATTATTTTTATACAAAATAAAAATATAACGACCGCCT
TTAAAAAAAAAAAAAAAA

RE39629.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:39:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG7519-RA 875 CG7519-RA 70..776 1..705 3465 99.5 Plus
CG7519.b 896 CG7519.b 198..797 108..705 2930 99.5 Plus
CG7519.a 699 CG7519.a 236..699 244..705 2250 99.3 Plus
CG7519.a 699 CG7519.a 20..237 1..218 1090 100 Plus
CG7519.b 896 CG7519.b 40..147 1..108 540 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:00:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 21482355..21482842 217..702 2360 99.4 Plus
chr3L 24539361 chr3L 21482182..21482290 108..216 545 100 Plus
chr3L 24539361 chr3L 21482024..21482131 1..108 540 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:54:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:00:21
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21493420..21493910 217..705 2375 99.4 Plus
3L 28110227 3L 21493247..21493355 108..216 545 100 Plus
3L 28110227 3L 21493089..21493196 1..108 540 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:07:04
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 21486520..21487010 217..705 2385 99.3 Plus
3L 28103327 3L 21486347..21486455 108..216 545 100 Plus
3L 28103327 3L 21486189..21486296 1..108 540 100 Plus
Blast to na_te.dros performed 2019-03-16 23:00:22
Subject Length Description Subject Range Query Range Score Percent Strand
roo 9092 roo DM_ROO 9092bp 8365..8413 650..698 119 71.4 Plus

RE39629.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:01:13 Download gff for RE39629.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 21482355..21482796 217..658 99 -> Plus
chr3L 21482024..21482131 1..108 100 -> Plus
chr3L 21482183..21482290 109..216 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:14:40 Download gff for RE39629.complete
Subject Subject Range Query Range Percent Splice Strand
CG7519-RA 1..483 97..579 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:04:23 Download gff for RE39629.complete
Subject Subject Range Query Range Percent Splice Strand
CG7519-RA 1..483 97..579 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:18:15 Download gff for RE39629.complete
Subject Subject Range Query Range Percent Splice Strand
CG7519-RA 1..483 97..579 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:29:05 Download gff for RE39629.complete
Subject Subject Range Query Range Percent Splice Strand
CG7519-RA 1..483 97..579 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:45:44 Download gff for RE39629.complete
Subject Subject Range Query Range Percent Splice Strand
CG7519-RA 1..483 97..579 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:31:51 Download gff for RE39629.complete
Subject Subject Range Query Range Percent Splice Strand
CG7519-RA 1..704 1..702 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:04:23 Download gff for RE39629.complete
Subject Subject Range Query Range Percent Splice Strand
CG7519-RA 20..723 1..702 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:18:15 Download gff for RE39629.complete
Subject Subject Range Query Range Percent Splice Strand
CG7519-RA 7..710 1..702 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:29:05 Download gff for RE39629.complete
Subject Subject Range Query Range Percent Splice Strand
CG7519-RA 1..704 1..702 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:45:44 Download gff for RE39629.complete
Subject Subject Range Query Range Percent Splice Strand
CG7519-RA 7..710 1..702 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:01:13 Download gff for RE39629.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21493089..21493196 1..108 100 -> Plus
3L 21493248..21493355 109..216 100 -> Plus
3L 21493420..21493907 217..702 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:01:13 Download gff for RE39629.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21493089..21493196 1..108 100 -> Plus
3L 21493248..21493355 109..216 100 -> Plus
3L 21493420..21493907 217..702 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:01:13 Download gff for RE39629.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21493089..21493196 1..108 100 -> Plus
3L 21493248..21493355 109..216 100 -> Plus
3L 21493420..21493907 217..702 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:18:15 Download gff for RE39629.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21486348..21486455 109..216 100 -> Plus
arm_3L 21486189..21486296 1..108 100 -> Plus
arm_3L 21486520..21487007 217..702 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:05:02 Download gff for RE39629.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21486520..21487007 217..702 99   Plus
3L 21486189..21486296 1..108 100 -> Plus
3L 21486348..21486455 109..216 100 -> Plus

RE39629.pep Sequence

Translation from 96 to 578

> RE39629.pep
MEMMHGASLLSRPAEEFGNDTLVEEMWAAKALEHAEVHFNLITSVHPSQL
KLTPYDDQIYATFRQDFPDLHVGRLTDDILKSATAKLKWRQFAEKFNKLD
DYSYGTLMRADASREFSPDNSIFVFRVQFLAIEIARNREGLNDEAYEKHK
PARKVPEEEQ*

RE39629.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:06:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23717-PA 162 GF23717-PA 1..160 1..160 755 86.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:06:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16190-PA 160 GG16190-PA 1..160 1..160 825 94.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:06:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14736-PA 163 GH14736-PA 1..155 1..155 735 84.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:05:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG7519-PA 160 CG7519-PA 1..160 1..160 834 100 Plus
CG7519-PB 151 CG7519-PB 1..151 1..160 769 94.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:06:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13392-PA 177 GI13392-PA 1..160 1..160 731 82.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:06:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12784-PA 164 GL12784-PA 1..160 1..160 762 85.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:06:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20409-PA 164 GA20409-PA 1..160 1..160 762 85.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:06:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22373-PA 160 GM22373-PA 1..160 1..160 838 98.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:06:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14964-PA 160 GD14964-PA 1..160 1..160 838 98.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:06:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11516-PA 163 GJ11516-PA 1..154 1..154 741 87.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:06:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13050-PA 164 GK13050-PA 1..160 1..160 697 80 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:06:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19760-PA 160 GE19760-PA 1..160 1..160 805 92.5 Plus
Dyak\GE23048-PA 160 GE23048-PA 1..160 1..160 805 92.5 Plus

RE39629.hyp Sequence

Translation from 96 to 578

> RE39629.hyp
MEMMHGASLLSRPAEEFGNDTLVEEMWAAKALEHAEVHFNLITSVHPSQL
KLTPYDDQIYATFRQDFPDLHVGRLTDDILKSATAKLKWRQFAEKFNKLD
DYSYGTLMRADASREFSPDNSIFVFRVQFLAIEIARNREGLNDEAYEKHK
PARKVPEEEQ*

RE39629.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:44:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG7519-PA 160 CG7519-PA 1..160 1..160 834 100 Plus
CG7519-PB 151 CG7519-PB 1..151 1..160 769 94.4 Plus