BDGP Sequence Production Resources |
Search the DGRC for RE39629
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 396 |
Well: | 29 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG7519-RA |
Protein status: | RE39629.pep: gold |
Preliminary Size: | 602 |
Sequenced Size: | 718 |
Gene | Date | Evidence |
---|---|---|
CG7519 | 2001-12-14 | Blastp of sequenced clone |
CG7519 | 2002-01-01 | Sim4 clustering to Release 2 |
CG7519 | 2003-01-01 | Sim4 clustering to Release 3 |
CG7519 | 2008-04-29 | Release 5.5 accounting |
CG7519 | 2008-08-15 | Release 5.9 accounting |
CG7519 | 2008-12-18 | 5.12 accounting |
718 bp (718 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071364
> RE39629.complete GACTTGCGGCTGGTCACACTGCGCTAAACAAAGTACGAAACGTGATTTTT CGTTTCAATAATTTTTAAAGTAAATAAGCAACCTTGTCCAAATAAAATGG AGATGATGCATGGAGCGTCGCTGCTGTCGCGGCCAGCGGAGGAATTTGGC AACGACACCCTGGTGGAGGAAATGTGGGCCGCAAAAGCTCTGGAACACGC CGAGGTGCACTTTAATCTCATCACCAGCGTCCATCCCTCCCAGCTGAAGC TCACGCCCTACGACGACCAGATATACGCCACTTTCCGGCAGGATTTTCCC GATCTTCACGTTGGCCGGCTTACCGATGATATTCTCAAATCCGCCACGGC GAAGCTCAAGTGGCGCCAGTTCGCCGAGAAGTTTAACAAGTTGGACGATT ACTCGTATGGCACCCTGATGCGCGCCGATGCCAGCAGGGAATTCTCCCCG GACAACTCTATCTTCGTGTTTCGCGTCCAGTTTCTGGCAATCGAGATTGC CCGGAATCGGGAGGGACTCAACGATGAGGCTTACGAGAAGCACAAGCCCG CCAGAAAGGTACCCGAAGAGGAACAGTAATCCCTCGCTCTAGCTTAGATT AAGTTGTAAAGACTGGATGCATATTTAGCTGCAGTTCGTCTATCTACTTT AGTAAACAATCAAATTATTTTTATACAAAATAAAAATATAACGACCGCCT TTAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG7519-RA | 875 | CG7519-RA | 70..776 | 1..705 | 3465 | 99.5 | Plus |
CG7519.b | 896 | CG7519.b | 198..797 | 108..705 | 2930 | 99.5 | Plus |
CG7519.a | 699 | CG7519.a | 236..699 | 244..705 | 2250 | 99.3 | Plus |
CG7519.a | 699 | CG7519.a | 20..237 | 1..218 | 1090 | 100 | Plus |
CG7519.b | 896 | CG7519.b | 40..147 | 1..108 | 540 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 21482355..21482842 | 217..702 | 2360 | 99.4 | Plus |
chr3L | 24539361 | chr3L | 21482182..21482290 | 108..216 | 545 | 100 | Plus |
chr3L | 24539361 | chr3L | 21482024..21482131 | 1..108 | 540 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 21493420..21493910 | 217..705 | 2375 | 99.4 | Plus |
3L | 28110227 | 3L | 21493247..21493355 | 108..216 | 545 | 100 | Plus |
3L | 28110227 | 3L | 21493089..21493196 | 1..108 | 540 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 21486520..21487010 | 217..705 | 2385 | 99.3 | Plus |
3L | 28103327 | 3L | 21486347..21486455 | 108..216 | 545 | 100 | Plus |
3L | 28103327 | 3L | 21486189..21486296 | 1..108 | 540 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
roo | 9092 | roo DM_ROO 9092bp | 8365..8413 | 650..698 | 119 | 71.4 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 21482355..21482796 | 217..658 | 99 | -> | Plus |
chr3L | 21482024..21482131 | 1..108 | 100 | -> | Plus |
chr3L | 21482183..21482290 | 109..216 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7519-RA | 1..483 | 97..579 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7519-RA | 1..483 | 97..579 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7519-RA | 1..483 | 97..579 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7519-RA | 1..483 | 97..579 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7519-RA | 1..483 | 97..579 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7519-RA | 1..704 | 1..702 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7519-RA | 20..723 | 1..702 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7519-RA | 7..710 | 1..702 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7519-RA | 1..704 | 1..702 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7519-RA | 7..710 | 1..702 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21493089..21493196 | 1..108 | 100 | -> | Plus |
3L | 21493248..21493355 | 109..216 | 100 | -> | Plus |
3L | 21493420..21493907 | 217..702 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21493089..21493196 | 1..108 | 100 | -> | Plus |
3L | 21493248..21493355 | 109..216 | 100 | -> | Plus |
3L | 21493420..21493907 | 217..702 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21493089..21493196 | 1..108 | 100 | -> | Plus |
3L | 21493248..21493355 | 109..216 | 100 | -> | Plus |
3L | 21493420..21493907 | 217..702 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 21486348..21486455 | 109..216 | 100 | -> | Plus |
arm_3L | 21486189..21486296 | 1..108 | 100 | -> | Plus |
arm_3L | 21486520..21487007 | 217..702 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21486520..21487007 | 217..702 | 99 | Plus | |
3L | 21486189..21486296 | 1..108 | 100 | -> | Plus |
3L | 21486348..21486455 | 109..216 | 100 | -> | Plus |
Translation from 96 to 578
> RE39629.pep MEMMHGASLLSRPAEEFGNDTLVEEMWAAKALEHAEVHFNLITSVHPSQL KLTPYDDQIYATFRQDFPDLHVGRLTDDILKSATAKLKWRQFAEKFNKLD DYSYGTLMRADASREFSPDNSIFVFRVQFLAIEIARNREGLNDEAYEKHK PARKVPEEEQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23717-PA | 162 | GF23717-PA | 1..160 | 1..160 | 755 | 86.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16190-PA | 160 | GG16190-PA | 1..160 | 1..160 | 825 | 94.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14736-PA | 163 | GH14736-PA | 1..155 | 1..155 | 735 | 84.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG7519-PA | 160 | CG7519-PA | 1..160 | 1..160 | 834 | 100 | Plus |
CG7519-PB | 151 | CG7519-PB | 1..151 | 1..160 | 769 | 94.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13392-PA | 177 | GI13392-PA | 1..160 | 1..160 | 731 | 82.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL12784-PA | 164 | GL12784-PA | 1..160 | 1..160 | 762 | 85.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20409-PA | 164 | GA20409-PA | 1..160 | 1..160 | 762 | 85.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM22373-PA | 160 | GM22373-PA | 1..160 | 1..160 | 838 | 98.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14964-PA | 160 | GD14964-PA | 1..160 | 1..160 | 838 | 98.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11516-PA | 163 | GJ11516-PA | 1..154 | 1..154 | 741 | 87.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13050-PA | 164 | GK13050-PA | 1..160 | 1..160 | 697 | 80 | Plus |
Translation from 96 to 578
> RE39629.hyp MEMMHGASLLSRPAEEFGNDTLVEEMWAAKALEHAEVHFNLITSVHPSQL KLTPYDDQIYATFRQDFPDLHVGRLTDDILKSATAKLKWRQFAEKFNKLD DYSYGTLMRADASREFSPDNSIFVFRVQFLAIEIARNREGLNDEAYEKHK PARKVPEEEQ*