BDGP Sequence Production Resources |
Search the DGRC for RE39820
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 398 |
Well: | 20 |
Vector: | pFlc-1 |
Associated Gene/Transcript | SmD3-RA |
Protein status: | RE39820.pep: gold |
Preliminary Size: | 721 |
Sequenced Size: | 753 |
Gene | Date | Evidence |
---|---|---|
CG8427 | 2002-01-01 | Sim4 clustering to Release 2 |
CG8427 | 2002-04-19 | Blastp of sequenced clone |
CG8427 | 2003-01-01 | Sim4 clustering to Release 3 |
SmD3 | 2008-04-29 | Release 5.5 accounting |
SmD3 | 2008-08-15 | Release 5.9 accounting |
SmD3 | 2008-12-18 | 5.12 accounting |
753 bp (753 high quality bases) assembled on 2002-04-19
GenBank Submission: AY113465
> RE39820.complete ACATACACTCGCAAACACTCGGCATAAACGCTTGCACAAAGAAAAACGGA GAAAAAATTTAGCGGTTTCGGTGGAAAAAAAAACAGTGAAAAATATATAG TTGAACGAACAAGAACAGACAGCAACACACCAAGCTAGCGAACATGTCTA TCGGAGTGCCCATTAAAGTTCTGCACGAGGCCGAGGGCCACATAATCACT TGCGAAACCATCACCGGCGAGGTGTACCGCGGCAAACTCATCGAGGCGGA GGACAACATGAACTGCCAAATGACCCAGATCACGGTGACCTACCGAGACG GACGCACCGCCAACCTGGAGAACGTCTACATTCGCGGCTCCAAGATCCGA TTCCTTATACTGCCCGACATGCTGAAAAATGCCCCGATGTTCAAGAAGCA GACGGGCAAGGGACTTGGTGGGACGGCGGGACGGGGCAAGGCGGCCATTC TGCGCGCACAGGCTCGTGGCAGAGGAAGAGGCGGACCTCCGGGCGGCGGA AGGGGCACTGGTGGACCGCCAGGAGCTCCCGGCGGCAGCGGCGGACGCGG AGCATGGCAGGGAGGACCAACCGGCGGTCGAGGACGCGGCGGCCTGTAGG AACTGCCTACTGAACAACGCATTTCTATTCTCTAAGTTGCGGGCATCATA TTATTAGCGGGCGGGTCGAACTTCTCCAGATGTTTTTTGTAAAGTATTTA TCGGGCAGAGCAGCCGAGAATACACTTGAAACTTGAATTTGAAAAAAAAA AAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 8055954..8056415 | 1..462 | 99 | -> | Plus |
chr2R | 8056945..8057223 | 463..741 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
SmD3-RA | 1..456 | 144..599 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
SmD3-RA | 1..456 | 144..599 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
SmD3-RA | 1..456 | 144..599 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
SmD3-RA | 1..456 | 144..599 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
SmD3-RA | 1..456 | 144..599 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
SmD3-RA | 9..749 | 1..741 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
SmD3-RA | 9..749 | 1..741 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
SmD3-RA | 4..744 | 1..741 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
SmD3-RA | 9..749 | 1..741 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
SmD3-RA | 4..744 | 1..741 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 12168734..12169195 | 1..462 | 100 | -> | Plus |
2R | 12169725..12170003 | 463..741 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 12168734..12169195 | 1..462 | 100 | -> | Plus |
2R | 12169725..12170003 | 463..741 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 12168734..12169195 | 1..462 | 100 | -> | Plus |
2R | 12169725..12170003 | 463..741 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 8056239..8056700 | 1..462 | 100 | -> | Plus |
arm_2R | 8057230..8057508 | 463..741 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 12169933..12170394 | 1..462 | 100 | -> | Plus |
2R | 12170924..12171202 | 463..741 | 100 | Plus |
Translation from 143 to 598
> RE39820.pep MSIGVPIKVLHEAEGHIITCETITGEVYRGKLIEAEDNMNCQMTQITVTY RDGRTANLENVYIRGSKIRFLILPDMLKNAPMFKKQTGKGLGGTAGRGKA AILRAQARGRGRGGPPGGGRGTGGPPGAPGGSGGRGAWQGGPTGGRGRGG L*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12297-PA | 151 | GF12297-PA | 1..151 | 1..151 | 747 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20251-PA | 151 | GG20251-PA | 1..151 | 1..151 | 759 | 100 | Plus |
Dere\GG23936-PA | 154 | GG23936-PA | 2..143 | 5..136 | 135 | 29.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH19718-PA | 151 | GH19718-PA | 1..151 | 1..151 | 722 | 98 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
SmD3-PA | 151 | CG8427-PA | 1..151 | 1..151 | 805 | 100 | Plus |
CG17768-PB | 154 | CG17768-PB | 2..143 | 5..147 | 157 | 29.9 | Plus |
CG17768-PA | 154 | CG17768-PA | 2..143 | 5..147 | 157 | 29.9 | Plus |
SmD1-PA | 124 | CG10753-PA | 8..118 | 7..121 | 139 | 32.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20137-PA | 151 | GI20137-PA | 1..151 | 1..151 | 722 | 98 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11081-PA | 150 | GL11081-PA | 1..150 | 1..151 | 733 | 98 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA24604-PA | 150 | GA24604-PA | 1..150 | 1..151 | 733 | 98 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21338-PA | 151 | GM21338-PA | 1..151 | 1..151 | 759 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD15400-PA | 151 | GD15400-PA | 1..151 | 1..151 | 759 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ19907-PA | 151 | GJ19907-PA | 1..151 | 1..151 | 716 | 97.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK23009-PA | 150 | GK23009-PA | 1..150 | 1..151 | 733 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12410-PA | 151 | GE12410-PA | 1..151 | 1..151 | 759 | 100 | Plus |
Translation from 143 to 598
> RE39820.hyp MSIGVPIKVLHEAEGHIITCETITGEVYRGKLIEAEDNMNCQMTQITVTY RDGRTANLENVYIRGSKIRFLILPDMLKNAPMFKKQTGKGLGGTAGRGKA AILRAQARGRGRGGPPGGGRGTGGPPGAPGGSGGRGAWQGGPTGGRGRGG L*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
SmD3-PA | 151 | CG8427-PA | 1..151 | 1..151 | 805 | 100 | Plus |
CG17768-PB | 154 | CG17768-PB | 2..143 | 5..147 | 157 | 29.9 | Plus |
CG17768-PA | 154 | CG17768-PA | 2..143 | 5..147 | 157 | 29.9 | Plus |
SmD1-PA | 124 | CG10753-PA | 8..118 | 7..121 | 139 | 32.5 | Plus |