Clone RE39820 Report

Search the DGRC for RE39820

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:398
Well:20
Vector:pFlc-1
Associated Gene/TranscriptSmD3-RA
Protein status:RE39820.pep: gold
Preliminary Size:721
Sequenced Size:753

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8427 2002-01-01 Sim4 clustering to Release 2
CG8427 2002-04-19 Blastp of sequenced clone
CG8427 2003-01-01 Sim4 clustering to Release 3
SmD3 2008-04-29 Release 5.5 accounting
SmD3 2008-08-15 Release 5.9 accounting
SmD3 2008-12-18 5.12 accounting

Clone Sequence Records

RE39820.complete Sequence

753 bp (753 high quality bases) assembled on 2002-04-19

GenBank Submission: AY113465

> RE39820.complete
ACATACACTCGCAAACACTCGGCATAAACGCTTGCACAAAGAAAAACGGA
GAAAAAATTTAGCGGTTTCGGTGGAAAAAAAAACAGTGAAAAATATATAG
TTGAACGAACAAGAACAGACAGCAACACACCAAGCTAGCGAACATGTCTA
TCGGAGTGCCCATTAAAGTTCTGCACGAGGCCGAGGGCCACATAATCACT
TGCGAAACCATCACCGGCGAGGTGTACCGCGGCAAACTCATCGAGGCGGA
GGACAACATGAACTGCCAAATGACCCAGATCACGGTGACCTACCGAGACG
GACGCACCGCCAACCTGGAGAACGTCTACATTCGCGGCTCCAAGATCCGA
TTCCTTATACTGCCCGACATGCTGAAAAATGCCCCGATGTTCAAGAAGCA
GACGGGCAAGGGACTTGGTGGGACGGCGGGACGGGGCAAGGCGGCCATTC
TGCGCGCACAGGCTCGTGGCAGAGGAAGAGGCGGACCTCCGGGCGGCGGA
AGGGGCACTGGTGGACCGCCAGGAGCTCCCGGCGGCAGCGGCGGACGCGG
AGCATGGCAGGGAGGACCAACCGGCGGTCGAGGACGCGGCGGCCTGTAGG
AACTGCCTACTGAACAACGCATTTCTATTCTCTAAGTTGCGGGCATCATA
TTATTAGCGGGCGGGTCGAACTTCTCCAGATGTTTTTTGTAAAGTATTTA
TCGGGCAGAGCAGCCGAGAATACACTTGAAACTTGAATTTGAAAAAAAAA
AAA

RE39820.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:15:34
Subject Length Description Subject Range Query Range Score Percent Strand
SmD3-RA 971 SmD3-RA 78..821 1..744 3720 100 Plus
SmD3.a 1380 SmD3.a 78..821 1..744 3720 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:28:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8055954..8056415 1..462 2280 99.6 Plus
chr2R 21145070 chr2R 8056944..8057223 462..741 1385 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:54:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:28:30
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12168734..12169195 1..462 2310 100 Plus
2R 25286936 2R 12169724..12170006 462..744 1415 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:45:40
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12169933..12170394 1..462 2310 100 Plus
2R 25260384 2R 12170923..12171205 462..744 1415 100 Plus
Blast to na_te.dros performed on 2019-03-16 13:28:30 has no hits.

RE39820.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:29:37 Download gff for RE39820.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8055954..8056415 1..462 99 -> Plus
chr2R 8056945..8057223 463..741 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:14:43 Download gff for RE39820.complete
Subject Subject Range Query Range Percent Splice Strand
SmD3-RA 1..456 144..599 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:06:27 Download gff for RE39820.complete
Subject Subject Range Query Range Percent Splice Strand
SmD3-RA 1..456 144..599 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:15:54 Download gff for RE39820.complete
Subject Subject Range Query Range Percent Splice Strand
SmD3-RA 1..456 144..599 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:55:34 Download gff for RE39820.complete
Subject Subject Range Query Range Percent Splice Strand
SmD3-RA 1..456 144..599 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:13:40 Download gff for RE39820.complete
Subject Subject Range Query Range Percent Splice Strand
SmD3-RA 1..456 144..599 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:44:00 Download gff for RE39820.complete
Subject Subject Range Query Range Percent Splice Strand
SmD3-RA 9..749 1..741 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:06:27 Download gff for RE39820.complete
Subject Subject Range Query Range Percent Splice Strand
SmD3-RA 9..749 1..741 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:15:54 Download gff for RE39820.complete
Subject Subject Range Query Range Percent Splice Strand
SmD3-RA 4..744 1..741 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:55:34 Download gff for RE39820.complete
Subject Subject Range Query Range Percent Splice Strand
SmD3-RA 9..749 1..741 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:13:40 Download gff for RE39820.complete
Subject Subject Range Query Range Percent Splice Strand
SmD3-RA 4..744 1..741 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:29:37 Download gff for RE39820.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12168734..12169195 1..462 100 -> Plus
2R 12169725..12170003 463..741 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:29:37 Download gff for RE39820.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12168734..12169195 1..462 100 -> Plus
2R 12169725..12170003 463..741 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:29:37 Download gff for RE39820.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12168734..12169195 1..462 100 -> Plus
2R 12169725..12170003 463..741 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:15:54 Download gff for RE39820.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8056239..8056700 1..462 100 -> Plus
arm_2R 8057230..8057508 463..741 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:27:53 Download gff for RE39820.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12169933..12170394 1..462 100 -> Plus
2R 12170924..12171202 463..741 100   Plus

RE39820.pep Sequence

Translation from 143 to 598

> RE39820.pep
MSIGVPIKVLHEAEGHIITCETITGEVYRGKLIEAEDNMNCQMTQITVTY
RDGRTANLENVYIRGSKIRFLILPDMLKNAPMFKKQTGKGLGGTAGRGKA
AILRAQARGRGRGGPPGGGRGTGGPPGAPGGSGGRGAWQGGPTGGRGRGG
L*

RE39820.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:12:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12297-PA 151 GF12297-PA 1..151 1..151 747 98.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:12:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20251-PA 151 GG20251-PA 1..151 1..151 759 100 Plus
Dere\GG23936-PA 154 GG23936-PA 2..143 5..136 135 29.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:12:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19718-PA 151 GH19718-PA 1..151 1..151 722 98 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:59
Subject Length Description Subject Range Query Range Score Percent Strand
SmD3-PA 151 CG8427-PA 1..151 1..151 805 100 Plus
CG17768-PB 154 CG17768-PB 2..143 5..147 157 29.9 Plus
CG17768-PA 154 CG17768-PA 2..143 5..147 157 29.9 Plus
SmD1-PA 124 CG10753-PA 8..118 7..121 139 32.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:12:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20137-PA 151 GI20137-PA 1..151 1..151 722 98 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:12:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11081-PA 150 GL11081-PA 1..150 1..151 733 98 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:12:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24604-PA 150 GA24604-PA 1..150 1..151 733 98 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:12:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21338-PA 151 GM21338-PA 1..151 1..151 759 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:12:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15400-PA 151 GD15400-PA 1..151 1..151 759 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:12:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19907-PA 151 GJ19907-PA 1..151 1..151 716 97.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:12:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23009-PA 150 GK23009-PA 1..150 1..151 733 98.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:12:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12410-PA 151 GE12410-PA 1..151 1..151 759 100 Plus

RE39820.hyp Sequence

Translation from 143 to 598

> RE39820.hyp
MSIGVPIKVLHEAEGHIITCETITGEVYRGKLIEAEDNMNCQMTQITVTY
RDGRTANLENVYIRGSKIRFLILPDMLKNAPMFKKQTGKGLGGTAGRGKA
AILRAQARGRGRGGPPGGGRGTGGPPGAPGGSGGRGAWQGGPTGGRGRGG
L*

RE39820.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:09:09
Subject Length Description Subject Range Query Range Score Percent Strand
SmD3-PA 151 CG8427-PA 1..151 1..151 805 100 Plus
CG17768-PB 154 CG17768-PB 2..143 5..147 157 29.9 Plus
CG17768-PA 154 CG17768-PA 2..143 5..147 157 29.9 Plus
SmD1-PA 124 CG10753-PA 8..118 7..121 139 32.5 Plus