Clone RE39879 Report

Search the DGRC for RE39879

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:398
Well:79
Vector:pFlc-1
Associated Gene/TranscriptLcp65Ab1-RA
Protein status:RE39879.pep: gold
Preliminary Size:419
Sequenced Size:429

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18773 2001-12-14 Blastp of sequenced clone
CG18776 2002-01-01 Sim4 clustering to Release 2
CG18773 2003-01-01 Sim4 clustering to Release 3
Lcp65Ab2 2008-04-29 Release 5.5 accounting
Lcp65Ab2 2008-08-15 Release 5.9 accounting
Lcp65Ab2 2008-12-18 5.12 accounting

Clone Sequence Records

RE39879.complete Sequence

429 bp (429 high quality bases) assembled on 2006-06-05

GenBank Submission: AY071366

> RE39879.complete
ATCAAACAGTTCCAAGTTTTCTAACAAACACCACACAGCTCCAACATGAA
ATTCCTCATCGTCTTCGTCGCCCTCTTCGCCATGGCAGTGGCCCGCCCCA
ACCTTGCCGAGATCGTGAGGCAGGTCTCCGATGTTGAGCCCGAGAAGTGG
AGCTCCGACGTGGAGACCAGCGATGGCACCAGCATCAAACAGGAGGGTGT
CCTCAAGAACGCTGGCACTGACAACGAGGCCGCTGTCGTCCACGGATCCT
TCACCTGGGTGGATGAGAAGACCGGCGAGAAGTTCACCATCACATACGTG
GCTGATGAGAACGGATACCAGCCCCAGGGCGCCCATCTGCCCGTGGCACC
AGTTGCTTAAGATGTTTTCCAAATCGATCAAAGAGTTTAAAATAAATCAA
AATGCTTTAAATTAAAAAAAAAAAAAAAA

RE39879.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:14:19
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp65Ab2-RA 419 Lcp65Ab2-RA 7..419 1..413 2065 100 Plus
Lcp65Ab1-RA 413 Lcp65Ab1-RA 1..413 1..413 2065 100 Plus
Lcp65Af-RA 771 Lcp65Af-RA 552..589 307..344 175 97.3 Plus
Lcp65Af-RA 771 Lcp65Af-RA 299..350 42..93 170 88.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:09:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 6139226..6139638 1..413 2065 100 Plus
chr3L 24539361 chr3L 6142097..6142509 1..413 2065 100 Plus
chr3L 24539361 chr3L 6140111..6140187 361..285 235 87 Minus
chr3L 24539361 chr3L 6142982..6143058 361..285 235 87 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:54:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:09:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6146677..6147092 1..416 2080 100 Plus
3L 28110227 3L 6149548..6149963 1..416 2080 100 Plus
3L 28110227 3L 6147562..6147638 361..285 235 87 Minus
3L 28110227 3L 6150433..6150509 361..285 235 87 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:07:59
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 6142648..6143063 1..416 2080 100 Plus
3L 28103327 3L 6139777..6140192 1..416 2080 100 Plus
3L 28103327 3L 6143533..6143609 361..285 235 87 Minus
3L 28103327 3L 6140662..6140738 361..285 235 87 Minus
3L 28103327 3L 6129496..6129533 344..307 175 97.3 Minus
3L 28103327 3L 6129793..6129844 93..42 170 88.4 Minus
3L 28103327 3L 6128273..6128314 86..45 165 92.8 Minus
3L 28103327 3L 6126592..6126633 86..45 165 92.8 Minus
3L 28103327 3L 6123989..6124030 86..45 165 92.8 Minus
3L 28103327 3L 6127934..6127991 361..304 155 84.4 Minus
3L 28103327 3L 6126253..6126310 361..304 155 84.4 Minus
3L 28103327 3L 6123650..6123707 361..304 140 82.7 Minus
Blast to na_te.dros performed on 2019-03-16 11:09:43 has no hits.

RE39879.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:10:30 Download gff for RE39879.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 6139226..6139638 1..413 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:14:45 Download gff for RE39879.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ab1-RA 1..315 46..360 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:23:44 Download gff for RE39879.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ab1-RA 1..315 46..360 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:08:27 Download gff for RE39879.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ab1-RA 1..315 46..360 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:42:33 Download gff for RE39879.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ab1-RA 1..315 46..360 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:29:17 Download gff for RE39879.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ab2-RA 1..315 46..360 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:52:00 Download gff for RE39879.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ab2-RA 7..419 1..413 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:23:44 Download gff for RE39879.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ab1-RA 1..413 1..413 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:08:27 Download gff for RE39879.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ab1-RA 1..413 1..413 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:42:33 Download gff for RE39879.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ab2-RA 7..419 1..413 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:29:17 Download gff for RE39879.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ab2-RA 4..416 1..413 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:10:30 Download gff for RE39879.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6146677..6147089 1..413 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:10:30 Download gff for RE39879.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6146677..6147089 1..413 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:10:30 Download gff for RE39879.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6146677..6147089 1..413 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:08:27 Download gff for RE39879.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6139777..6140189 1..413 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:51:35 Download gff for RE39879.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6139777..6140189 1..413 100   Plus

RE39879.hyp Sequence

Translation from 45 to 359

> RE39879.hyp
MKFLIVFVALFAMAVARPNLAEIVRQVSDVEPEKWSSDVETSDGTSIKQE
GVLKNAGTDNEAAVVHGSFTWVDEKTGEKFTITYVADENGYQPQGAHLPV
APVA*

RE39879.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:06:44
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp65Ab1-PA 104 CG32400-PA 1..104 1..104 533 100 Plus
Lcp65Ab2-PA 104 CG18773-PA 1..104 1..104 533 100 Plus
Cpr65Ax1-PA 102 CG34270-PA 1..102 1..104 301 61.5 Plus
Cpr65Ax2-PB 102 CG18777-PB 1..102 1..104 301 61.5 Plus
Cpr65Ax2-PA 102 CG18777-PA 1..102 1..104 301 61.5 Plus

RE39879.pep Sequence

Translation from 45 to 359

> RE39879.pep
MKFLIVFVALFAMAVARPNLAEIVRQVSDVEPEKWSSDVETSDGTSIKQE
GVLKNAGTDNEAAVVHGSFTWVDEKTGEKFTITYVADENGYQPQGAHLPV
APVA*

RE39879.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:29:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23522-PA 105 GF23522-PA 1..105 1..104 450 82.9 Plus
Dana\GF23523-PA 105 GF23523-PA 1..105 1..104 440 79 Plus
Dana\GF23524-PA 105 GF23524-PA 1..105 1..104 440 79 Plus
Dana\GF10921-PA 101 GF10921-PA 1..101 1..104 287 55.8 Plus
Dana\GF10925-PA 107 GF10925-PA 1..101 1..103 247 60.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:29:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15327-PA 104 GG15327-PA 1..104 1..104 447 80.8 Plus
Dere\GG14079-PA 106 GG14079-PA 26..106 23..104 249 56.1 Plus
Dere\GG15325-PA 108 GG15325-PA 1..104 1..99 244 51.4 Plus
Dere\GG14083-PA 105 GG14083-PA 1..105 1..104 237 58.5 Plus
Dere\GG14082-PA 107 GG14082-PA 26..107 22..104 232 50.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:29:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15651-PA 99 GH15651-PA 1..99 1..101 324 62.4 Plus
Dgri\GH15650-PA 101 GH15650-PA 1..97 1..99 299 59.6 Plus
Dgri\GH13967-PA 99 GH13967-PA 1..99 1..101 293 60.4 Plus
Dgri\GH15648-PA 99 GH15648-PA 1..99 1..101 287 58.4 Plus
Dgri\GH15649-PA 96 GH15649-PA 1..96 1..101 261 58.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:33:24
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp65Ab1-PA 104 CG32400-PA 1..104 1..104 533 100 Plus
Lcp65Ab2-PA 104 CG18773-PA 1..104 1..104 533 100 Plus
Cpr65Ax2-PB 102 CG18777-PB 1..102 1..104 301 61.5 Plus
Cpr65Ax2-PA 102 CG18777-PA 1..102 1..104 301 61.5 Plus
Cpr65Ax1-PA 102 CG34270-PA 1..102 1..104 301 61.5 Plus
Lcp65Af-PA 100 CG10533-PA 1..99 1..103 278 58.3 Plus
Lcp65Ag2-PA 105 CG10534-PA 1..105 1..104 276 55.7 Plus
Lcp65Ag1-PA 105 CG10530-PA 1..105 1..104 276 55.7 Plus
Lcp65Ag3-PA 105 CG18779-PA 1..105 1..104 273 54.7 Plus
Lcp65Ae-PA 99 CG10529-PA 1..98 1..101 252 53.5 Plus
Lcp65Ac-PA 109 CG6956-PA 7..107 5..103 248 49 Plus
Lcp65Ad-PB 108 CG6955-PB 1..104 1..99 227 48.6 Plus
Lcp65Ad-PA 108 CG6955-PA 1..104 1..99 227 48.6 Plus
Acp65Aa-PA 105 CG10297-PA 2..104 1..99 202 46.2 Plus
Lcp65Aa-PA 102 CG7287-PA 1..100 1..99 197 46.1 Plus
Cpr49Aa-PB 144 CG30045-PB 1..112 1..102 187 39.8 Plus
Cpr65Av-PA 111 CG32405-PA 31..109 21..99 178 46.2 Plus
Cpr47Ea-PA 135 CG9079-PA 41..122 21..102 166 42.2 Plus
Cpr65Aw-PA 117 CG32404-PA 8..104 3..99 161 36.7 Plus
Cpr49Af-PB 126 CG8510-PB 1..101 1..102 160 35.9 Plus
Cpr49Af-PA 126 CG8510-PA 1..101 1..102 160 35.9 Plus
Cpr65Az-PA 239 CG12330-PA 132..196 38..102 155 45.5 Plus
Cpr65Aw-PB 86 CG32404-PB 11..73 36..99 149 48.4 Plus
Cpr67Fa1-PA 134 CG7941-PA 3..100 2..102 142 36.4 Plus
Lcp1-PB 130 CG11650-PB 5..104 5..102 141 30.3 Plus
Lcp1-PA 130 CG11650-PA 5..104 5..102 141 30.3 Plus
Cpr67Fa2-PA 134 CG18349-PA 3..100 2..102 139 35.5 Plus
Cpr49Ae-PA 134 CG8505-PA 8..112 5..102 135 34.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:29:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12627-PA 112 GI12627-PA 1..112 1..104 279 53.5 Plus
Dmoj\GI12628-PA 104 GI12628-PA 1..104 1..101 278 56.6 Plus
Dmoj\GI12696-PA 100 GI12696-PA 1..100 1..101 250 59.4 Plus
Dmoj\GI12695-PA 100 GI12695-PA 1..100 1..101 234 55.4 Plus
Dmoj\GI12620-PA 104 GI12620-PA 1..102 1..99 220 43.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:29:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15521-PA 102 GL15521-PA 1..101 1..101 283 55.9 Plus
Dper\GL15558-PA 104 GL15558-PA 1..104 1..104 262 55.2 Plus
Dper\GL15559-PA 101 GL15559-PA 1..101 1..101 241 53.9 Plus
Dper\GL15520-PA 104 GL15520-PA 1..104 1..104 240 57.1 Plus
Dper\GL15517-PA 104 GL15517-PA 1..104 1..104 240 57.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:29:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15076-PA 104 GA15076-PA 1..104 1..104 262 55.2 Plus
Dpse\GA23851-PA 104 GA23851-PA 1..104 1..104 240 57.1 Plus
Dpse\GA23849-PA 101 GA23849-PA 1..101 1..101 239 52.9 Plus
Dpse\GA23852-PA 104 GA23852-PA 1..104 1..104 239 57.1 Plus
Dpse\GA23448-PA 101 GA23448-PA 1..101 1..101 238 52.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:29:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14764-PA 104 GM14764-PA 1..104 1..104 459 83.7 Plus
Dsec\GM14761-PA 104 GM14761-PA 1..104 1..104 457 83.7 Plus
Dsec\GM19679-PA 104 GM19679-PA 1..104 1..104 457 83.7 Plus
Dsec\GM19680-PA 104 GM19680-PA 1..104 1..104 450 82.7 Plus
Dsec\GM14763-PA 104 GM14763-PA 1..104 1..104 450 82.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:29:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13940-PA 104 GD13940-PA 1..104 1..104 445 78.8 Plus
Dsim\GD13942-PA 104 GD13942-PA 1..104 1..104 444 76.9 Plus
Dsim\GD13941-PA 104 GD13941-PA 1..104 1..104 438 76.9 Plus
Dsim\GD14953-PA 101 GD14953-PA 1..101 1..104 274 54.8 Plus
Dsim\GD13939-PA 107 GD13939-PA 24..106 21..104 230 51.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:29:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12742-PA 102 GJ12742-PA 1..102 1..101 265 51.5 Plus
Dvir\GJ12680-PA 105 GJ12680-PA 1..105 1..104 263 60.4 Plus
Dvir\GJ12681-PA 105 GJ12681-PA 1..105 1..104 263 60.4 Plus
Dvir\GJ12677-PA 106 GJ12677-PA 1..106 1..104 244 55.7 Plus
Dvir\GJ12752-PA 103 GJ12752-PA 1..103 1..104 243 55.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:29:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17271-PA 102 GK17271-PA 1..101 1..102 387 70.6 Plus
Dwil\GK17270-PA 101 GK17270-PA 1..101 1..102 365 65.7 Plus
Dwil\GK16921-PA 105 GK16921-PA 1..103 1..102 291 56.7 Plus
Dwil\GK16914-PA 104 GK16914-PA 1..102 1..102 276 54.4 Plus
Dwil\GK17269-PA 108 GK17269-PA 1..107 1..104 266 50.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:29:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20505-PA 118 GE20505-PA 15..118 1..104 450 81.7 Plus
Dyak\GE21545-PA 104 GE21545-PA 1..104 1..104 445 80.8 Plus
Dyak\GE21544-PA 118 GE21544-PA 15..118 1..104 445 80.8 Plus
Dyak\GE20504-PA 104 GE20504-PA 1..104 1..104 438 79.8 Plus
Dyak\GE20502-PA 195 GE20502-PA 133..195 39..101 275 82.5 Plus
Dyak\GE20502-PA 195 GE20502-PA 2..104 1..99 206 46.2 Plus