Clone RE40068 Report

Search the DGRC for RE40068

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:400
Well:68
Vector:pFlc-1
Associated Gene/Transcriptsala-RA
Protein status:RE40068.pep: gold
Preliminary Size:668
Sequenced Size:707

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4922 2002-01-01 Sim4 clustering to Release 2
CG4922 2002-01-09 Blastp of sequenced clone
CG4922 2003-01-01 Sim4 clustering to Release 3
sala 2008-04-29 Release 5.5 accounting
sala 2008-08-15 Release 5.9 accounting
sala 2008-12-18 5.12 accounting

Clone Sequence Records

RE40068.complete Sequence

707 bp (707 high quality bases) assembled on 2002-01-09

GenBank Submission: AY075486

> RE40068.complete
AGTACCGAAACTTCAGCCACGATGAAACTACTGATTGCTCTGTTTGCACT
GGTGACCGCTGTGAACGCTCAGAATGGATTCGGCCAAGTTGGACAAGGAG
GATATGGAGGGCAAGGAGGATTTGGAGGATTCGGAGGAATCGGCGGGCAA
GCAGGTTTTGGTGGACAAATAGGATTCACTGGACAGGGTGGAGTTGGTGG
CCAGGTGGGAATTGGTCAAGGCGGAGTCCACCCGGGTCAAGGAGGATTCG
CTGGACAAGGTTCTCCAAACCAATATCAGCCTGGTTACGGAAGTCCTGTG
GGATCTGGCCATTTCCATGGAACTAATCCAGTTGAGTCCGGTCATTTTCA
CGAAAATCCTCATGAATATCCGGAACATCATGGCGATCATCACCGTGAAC
ATCATGAGCACCATGGACACCACGAACATCATGGACATCATAGACATTAG
TACAAATATGAGAATACCCATGACAAAATTAAAGGAATGTAATGCTATAG
TTCTCTACCGTAAATTCTTAAGAAACACTTGCTTGTTTCTGAAGTCTCTA
TTGTATCTAATGTCCAGAATTGATTTGTAAAAGTGATTCTTTATCTAAAA
CCCCCTTGAGATCCACTATACAACGTGCCTTCTTGAATTTCAGTATCTAA
AATGAAAAAAAAAACGGAGTCTCAATAAAAAAGTAAATAAGAAAAAAAAA
AAAAAAA

RE40068.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:31:31
Subject Length Description Subject Range Query Range Score Percent Strand
sala-RA 966 sala-RA 140..834 1..695 3460 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:28:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 11485008..11485673 26..691 3300 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:54:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:28:53
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11486284..11486953 26..695 3305 99.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:59:44
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11486284..11486953 26..695 3305 99.5 Plus
2L 23513712 2L 11486189..11486221 1..33 165 100 Plus
Blast to na_te.dros performed 2019-03-15 16:28:54
Subject Length Description Subject Range Query Range Score Percent Strand
accord2 7650 accord2 QBERT 7650bp 4961..5001 489..449 106 73.2 Minus

RE40068.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:30:05 Download gff for RE40068.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 11484913..11484945 1..33 100 -> Plus
chr2L 11485016..11485673 34..691 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:14:54 Download gff for RE40068.complete
Subject Subject Range Query Range Percent Splice Strand
sala-RA 1..429 22..450 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:51:38 Download gff for RE40068.complete
Subject Subject Range Query Range Percent Splice Strand
sala-RA 1..429 22..450 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:02:42 Download gff for RE40068.complete
Subject Subject Range Query Range Percent Splice Strand
sala-RA 1..429 22..450 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:17:45 Download gff for RE40068.complete
Subject Subject Range Query Range Percent Splice Strand
sala-RA 1..429 22..450 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:37:15 Download gff for RE40068.complete
Subject Subject Range Query Range Percent Splice Strand
sala-RA 1..429 22..450 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:15:16 Download gff for RE40068.complete
Subject Subject Range Query Range Percent Splice Strand
sala-RA 1..691 1..691 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:51:38 Download gff for RE40068.complete
Subject Subject Range Query Range Percent Splice Strand
sala-RA 1..691 1..691 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:02:42 Download gff for RE40068.complete
Subject Subject Range Query Range Percent Splice Strand
sala-RA 8..698 1..691 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:17:46 Download gff for RE40068.complete
Subject Subject Range Query Range Percent Splice Strand
sala-RA 1..691 1..691 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:37:15 Download gff for RE40068.complete
Subject Subject Range Query Range Percent Splice Strand
sala-RA 8..698 1..691 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:30:05 Download gff for RE40068.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11486189..11486221 1..33 100 -> Plus
2L 11486292..11486949 34..691 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:30:05 Download gff for RE40068.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11486189..11486221 1..33 100 -> Plus
2L 11486292..11486949 34..691 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:30:05 Download gff for RE40068.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11486189..11486221 1..33 100 -> Plus
2L 11486292..11486949 34..691 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:02:42 Download gff for RE40068.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11486189..11486221 1..33 100 -> Plus
arm_2L 11486292..11486949 34..691 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:51:51 Download gff for RE40068.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11486292..11486949 34..691 100   Plus
2L 11486189..11486221 1..33 100 -> Plus

RE40068.hyp Sequence

Translation from 0 to 449

> RE40068.hyp
STETSATMKLLIALFALVTAVNAQNGFGQVGQGGYGGQGGFGGFGGIGGQ
AGFGGQIGFTGQGGVGGQVGIGQGGVHPGQGGFAGQGSPNQYQPGYGSPV
GSGHFHGTNPVESGHFHENPHEYPEHHGDHHREHHEHHGHHEHHGHHRH*

RE40068.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:05:09
Subject Length Description Subject Range Query Range Score Percent Strand
sala-PC 142 CG4922-PC 1..142 8..149 826 100 Plus
sala-PA 142 CG4922-PA 1..142 8..149 826 100 Plus
CG8157-PB 113 CG8157-PB 1..111 8..145 238 48.2 Plus
CG8157-PA 113 CG8157-PA 1..111 8..145 238 48.2 Plus
CG7299-PC 177 CG7299-PC 68..131 24..90 203 61.2 Plus

RE40068.pep Sequence

Translation from 21 to 449

> RE40068.pep
MKLLIALFALVTAVNAQNGFGQVGQGGYGGQGGFGGFGGIGGQAGFGGQI
GFTGQGGVGGQVGIGQGGVHPGQGGFAGQGSPNQYQPGYGSPVGSGHFHG
TNPVESGHFHENPHEYPEHHGDHHREHHEHHGHHEHHGHHRH*

RE40068.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:04:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23722-PA 154 GG23722-PA 82..147 70..135 152 83.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:26
Subject Length Description Subject Range Query Range Score Percent Strand
sala-PC 142 CG4922-PC 1..142 1..142 826 100 Plus
sala-PA 142 CG4922-PA 1..142 1..142 826 100 Plus
CG8157-PB 113 CG8157-PB 1..111 1..138 238 48.2 Plus
CG8157-PA 113 CG8157-PA 1..111 1..138 238 48.2 Plus
CG7299-PC 177 CG7299-PC 68..131 17..83 203 61.2 Plus
CG7299-PA 177 CG7299-PA 68..131 17..83 203 61.2 Plus
CG7299-PC 177 CG7299-PC 57..128 19..102 195 53.6 Plus
CG7299-PA 177 CG7299-PA 57..128 19..102 195 53.6 Plus
prc-PB 1713 CG5700-PB 938..1031 12..100 184 48.9 Plus
prc-PB 1713 CG5700-PB 986..1073 14..96 176 48.9 Plus
Cpr47Ef-PD 601 CG13214-PD 296..387 16..100 176 46.8 Plus
Cpr47Ef-PC 612 CG13214-PC 296..387 16..100 176 46.8 Plus
nocte-PD 2305 CG17255-PD 192..347 18..142 175 32.9 Plus
nocte-PB 2309 CG17255-PB 192..347 18..142 175 32.9 Plus
nocte-PA 2309 CG17255-PA 192..347 18..142 175 32.9 Plus
nocte-PC 2309 CG17255-PC 192..347 18..142 175 32.9 Plus
CG7296-PB 161 CG7296-PB 1..106 1..103 174 43.4 Plus
CG7296-PA 161 CG7296-PA 1..106 1..103 174 43.4 Plus
CG10918-PA 183 CG10918-PA 5..105 3..96 173 44.3 Plus
prc-PB 1713 CG5700-PB 633..735 14..107 172 48.1 Plus
Cpr47Ef-PD 601 CG13214-PD 369..444 21..100 169 50 Plus
Cpr47Ef-PC 612 CG13214-PC 369..444 21..100 169 50 Plus
CG17105-PB 103 CG17105-PB 1..81 1..77 166 45.7 Plus
CG17105-PA 103 CG17105-PA 1..81 1..77 166 45.7 Plus
Cpr47Ef-PC 612 CG13214-PC 427..516 13..90 165 45.6 Plus
CG8160-PA 212 CG8160-PA 1..98 1..92 163 42.1 Plus
CG8160-PA 212 CG8160-PA 64..212 17..140 162 37 Plus
prc-PB 1713 CG5700-PB 440..540 14..103 161 46.1 Plus
prc-PB 1713 CG5700-PB 1003..1090 14..96 161 47.3 Plus
Cpr47Ef-PC 612 CG13214-PC 465..549 21..103 161 46 Plus
na-PG 2224 CG1517-PG 26..147 19..142 159 34.1 Plus
na-PF 2233 CG1517-PF 26..147 19..142 159 34.1 Plus
prc-PB 1713 CG5700-PB 457..549 14..96 158 47.9 Plus
Cpr47Ef-PD 601 CG13214-PD 427..505 13..90 158 48.2 Plus
prc-PB 1713 CG5700-PB 593..682 14..103 156 45.7 Plus
prc-PB 1713 CG5700-PB 1032..1119 14..94 154 47.2 Plus
prc-PB 1713 CG5700-PB 219..319 14..103 153 46.1 Plus
prc-PB 1713 CG5700-PB 474..574 14..103 151 41.2 Plus
Cpr47Ef-PD 601 CG13214-PD 281..369 19..107 151 44.7 Plus
Cpr47Ef-PC 612 CG13214-PC 281..369 19..107 151 44.7 Plus
Cpr47Ef-PC 612 CG13214-PC 399..488 21..96 151 46.8 Plus
prc-PB 1713 CG5700-PB 126..225 6..101 150 43.4 Plus
CG9757-PB 127 CG9757-PB 51..112 26..94 150 56.5 Plus
CG9757-PA 127 CG9757-PA 51..112 26..94 150 56.5 Plus
prc-PB 1713 CG5700-PB 304..404 14..103 149 41.2 Plus
prc-PB 1713 CG5700-PB 525..625 14..103 149 41.2 Plus
prc-PB 1713 CG5700-PB 820..924 14..96 148 40 Plus
Cpr47Ef-PD 601 CG13214-PD 248..330 19..103 147 45.6 Plus
Cpr47Ef-PC 612 CG13214-PC 248..330 19..103 147 45.6 Plus
prc-PB 1713 CG5700-PB 355..447 14..96 146 42.6 Plus
CG9757-PB 127 CG9757-PB 59..126 19..94 146 57 Plus
CG9757-PA 127 CG9757-PA 59..126 19..94 146 57 Plus
CG34166-PD 82 CG34166-PD 1..79 1..90 146 47.8 Plus
CG34166-PC 82 CG34166-PC 1..79 1..90 146 47.8 Plus
CG34166-PB 82 CG34166-PB 1..79 1..90 146 47.8 Plus
CG34166-PA 82 CG34166-PA 1..79 1..90 146 47.8 Plus
Cpr47Ef-PC 612 CG13214-PC 471..546 19..96 145 49.4 Plus
CG15140-PB 335 CG15140-PB 221..319 18..116 145 38.5 Plus
CG17108-PA 342 CG17108-PA 164..263 19..100 145 42.3 Plus
CG7296-PB 161 CG7296-PB 55..115 19..80 142 54 Plus
CG7296-PA 161 CG7296-PA 55..115 19..80 142 54 Plus
CG5172-PD 172 CG5172-PD 13..122 3..124 142 41.5 Plus
Fib-PA 344 CG9888-PA 25..119 17..111 142 42.7 Plus
CG9757-PB 127 CG9757-PB 52..127 19..100 141 53.4 Plus
CG9757-PA 127 CG9757-PA 52..127 19..100 141 53.4 Plus
CG9269-PA 146 CG9269-PA 48..145 24..113 136 39.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:04:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19072-PA 142 GM19072-PA 1..135 1..135 231 92.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:04:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\sala-PA 142 GD23778-PA 1..135 1..135 226 91.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:04:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18526-PA 140 GE18526-PA 1..133 1..135 173 71.3 Plus