BDGP Sequence Production Resources |
Search the DGRC for RE40155
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 401 |
Well: | 55 |
Vector: | pFlc-1 |
Associated Gene/Transcript | mtacp1-RA |
Protein status: | RE40155.pep: gold |
Sequenced Size: | 613 |
Gene | Date | Evidence |
---|---|---|
Lost to the ancients | 2010-01-15 | I'm sure there was a reason |
613 bp assembled on 2010-01-18
GenBank Submission: BT120138.1
> RE40155.complete CTTTTTCTTGCTCCAGCACTTTTACATAATCTTGAAAACTCAGCGAGAAC CGAGATGTCGTTCACACAGATCGCGCGCAGCTGCAGTCGACTGGCGGCCA CTTTGGCCCCAAGGAGGGTCGCCTCCGGCATTCTCATCCAATCACAGGCC TCCAGGATGATGCACAGGATCGCCGTGCCATCGATGACCAGCCAGTTGAG CCAAGAGTGCCGTGGTCGCTGGCAAACGCAATTGGTGCGCAGATACTCGG CGAAACCGCCGCTCTCGCTGAAGCTGATCAATGAGCGCGTCTTGCTTGTG CTCAAGCTCTACGACAAGATCGATCCCAGCAAGCTCAACGTTGAGTCGCA CTTCATCAACGACTTGGGACTGGATTCCTTGGACCACGTGGAGGTCATCA TGGCCATGGAGGACGAGTTCGGTTTCGAGATCCCCGACTCTGATGCCGAG AAGCTGCTTAAACCTGCCGACATTATTAAGTACGTCGCCGACAAGGAGGA TGTGTACGAGTAAATTGTAATTGTAATGCAAGCCATTGAACGGATTACAC TTAAATTTAAATAGAAAACAAGTCAAATACAATTTGATCAACTGAATAAA AAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mtacp1-RA | 931 | mtacp1-RA | 199..798 | 1..600 | 3000 | 100 | Plus |
mtacp1.a | 972 | mtacp1.a | 488..885 | 203..600 | 1990 | 100 | Plus |
mtacp1-RB | 904 | mtacp1-RB | 502..771 | 331..600 | 1350 | 100 | Plus |
mtacp1.a | 972 | mtacp1.a | 199..406 | 1..208 | 1025 | 99.5 | Plus |
mtacp1-RB | 904 | mtacp1-RB | 199..406 | 1..208 | 1025 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 1330790..1331055 | 332..597 | 1330 | 100 | Plus |
chr3L | 24539361 | chr3L | 1329643..1329803 | 45..205 | 805 | 100 | Plus |
chr3L | 24539361 | chr3L | 1330550..1330689 | 201..340 | 655 | 97.9 | Plus |
chr3L | 24539361 | chr3L | 1329516..1329560 | 1..45 | 225 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 1331278..1331546 | 332..600 | 1345 | 100 | Plus |
3L | 28110227 | 3L | 1330131..1330291 | 45..205 | 805 | 100 | Plus |
3L | 28110227 | 3L | 1331038..1331177 | 201..340 | 655 | 97.9 | Plus |
3L | 28110227 | 3L | 1330004..1330048 | 1..45 | 225 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 1331278..1331546 | 332..600 | 1345 | 100 | Plus |
3L | 28103327 | 3L | 1330131..1330291 | 45..205 | 805 | 100 | Plus |
3L | 28103327 | 3L | 1331038..1331177 | 201..340 | 655 | 97.8 | Plus |
3L | 28103327 | 3L | 1330004..1330048 | 1..45 | 225 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X-element | 4740 | X-element ROXELEMENT 4740bp | 3462..3553 | 409..500 | 117 | 61.3 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 1329516..1329559 | 1..44 | 100 | -> | Plus |
chr3L | 1329643..1329802 | 45..204 | 100 | -> | Plus |
chr3L | 1330554..1330682 | 205..333 | 100 | -> | Plus |
chr3L | 1330792..1331055 | 334..597 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mtacp1-RA | 1..459 | 55..513 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mtacp1-RA | 1..459 | 55..513 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mtacp1-RA | 1..459 | 55..513 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mtacp1-RA | 1..459 | 55..513 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mtacp1-RA | 199..795 | 1..597 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mtacp1-RA | 199..795 | 1..597 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mtacp1-RA | 56..652 | 1..597 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mtacp1-RA | 56..652 | 1..597 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 1330004..1330047 | 1..44 | 100 | -> | Plus |
3L | 1330131..1330290 | 45..204 | 100 | -> | Plus |
3L | 1331042..1331170 | 205..333 | 100 | -> | Plus |
3L | 1331280..1331543 | 334..597 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 1330004..1330047 | 1..44 | 100 | -> | Plus |
3L | 1330131..1330290 | 45..204 | 100 | -> | Plus |
3L | 1331042..1331170 | 205..333 | 100 | -> | Plus |
3L | 1331280..1331543 | 334..597 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 1330004..1330047 | 1..44 | 100 | -> | Plus |
3L | 1330131..1330290 | 45..204 | 100 | -> | Plus |
3L | 1331042..1331170 | 205..333 | 100 | -> | Plus |
3L | 1331280..1331543 | 334..597 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 1331042..1331170 | 205..333 | 100 | -> | Plus |
arm_3L | 1330004..1330047 | 1..44 | 100 | -> | Plus |
arm_3L | 1330131..1330290 | 45..204 | 100 | -> | Plus |
arm_3L | 1331280..1331543 | 334..597 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 1331280..1331543 | 334..597 | 100 | Plus | |
3L | 1330004..1330047 | 1..44 | 100 | -> | Plus |
3L | 1330131..1330290 | 45..204 | 100 | -> | Plus |
3L | 1331042..1331170 | 205..333 | 100 | -> | Plus |
Translation from 0 to 512
> RE40155.hyp LFLAPALLHNLENSARTEMSFTQIARSCSRLAATLAPRRVASGILIQSQA SRMMHRIAVPSMTSQLSQECRGRWQTQLVRRYSAKPPLSLKLINERVLLV LKLYDKIDPSKLNVESHFINDLGLDSLDHVEVIMAMEDEFGFEIPDSDAE KLLKPADIIKYVADKEDVYE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mtacp1-PA | 152 | CG9160-PA | 1..152 | 19..170 | 761 | 100 | Plus |
mtacp1-PC | 181 | CG9160-PC | 1..181 | 19..170 | 721 | 84 | Plus |
mtacp1-PB | 143 | CG9160-PB | 1..143 | 19..170 | 572 | 81.6 | Plus |
Translation from 0 to 512
> RE40155.pep LFLAPALLHNLENSARTEMSFTQIARSCSRLAATLAPRRVASGILIQSQA SRMMHRIAVPSMTSQLSQECRGRWQTQLVRRYSAKPPLSLKLINERVLLV LKLYDKIDPSKLNVESHFINDLGLDSLDHVEVIMAMEDEFGFEIPDSDAE KLLKPADIIKYVADKEDVYE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24455-PA | 185 | GF24455-PA | 1..185 | 19..170 | 678 | 72 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14782-PA | 186 | GG14782-PA | 1..186 | 19..170 | 751 | 79 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15216-PA | 184 | GH15216-PA | 1..184 | 19..170 | 619 | 68.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
ND-ACP-PA | 152 | CG9160-PA | 1..152 | 19..170 | 761 | 100 | Plus |
ND-ACP-PC | 181 | CG9160-PC | 1..181 | 19..170 | 721 | 84 | Plus |
ND-ACP-PB | 143 | CG9160-PB | 1..143 | 19..170 | 572 | 81.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11927-PA | 186 | GI11927-PA | 1..186 | 19..170 | 606 | 66.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL16180-PA | 189 | GL16180-PA | 1..189 | 19..170 | 623 | 65.6 | Plus |
Dper\GL21696-PA | 143 | GL21696-PA | 1..143 | 19..170 | 519 | 67.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA21583-PA | 189 | GA21583-PA | 1..189 | 19..170 | 638 | 67.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14402-PA | 186 | GM14402-PA | 1..186 | 19..170 | 762 | 81.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD13611-PA | 186 | GD13611-PA | 1..186 | 19..170 | 762 | 81.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12150-PA | 184 | GJ12150-PA | 1..184 | 19..170 | 619 | 67.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13357-PA | 181 | GK13357-PA | 1..181 | 19..170 | 583 | 66.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\mtacp1-PA | 186 | GE21146-PA | 1..186 | 19..170 | 761 | 81.2 | Plus |