Clone RE40155 Report

Search the DGRC for RE40155

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:401
Well:55
Vector:pFlc-1
Associated Gene/Transcriptmtacp1-RA
Protein status:RE40155.pep: gold
Sequenced Size:613

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Lost to the ancients 2010-01-15 I'm sure there was a reason

Clone Sequence Records

RE40155.complete Sequence

613 bp assembled on 2010-01-18

GenBank Submission: BT120138.1

> RE40155.complete
CTTTTTCTTGCTCCAGCACTTTTACATAATCTTGAAAACTCAGCGAGAAC
CGAGATGTCGTTCACACAGATCGCGCGCAGCTGCAGTCGACTGGCGGCCA
CTTTGGCCCCAAGGAGGGTCGCCTCCGGCATTCTCATCCAATCACAGGCC
TCCAGGATGATGCACAGGATCGCCGTGCCATCGATGACCAGCCAGTTGAG
CCAAGAGTGCCGTGGTCGCTGGCAAACGCAATTGGTGCGCAGATACTCGG
CGAAACCGCCGCTCTCGCTGAAGCTGATCAATGAGCGCGTCTTGCTTGTG
CTCAAGCTCTACGACAAGATCGATCCCAGCAAGCTCAACGTTGAGTCGCA
CTTCATCAACGACTTGGGACTGGATTCCTTGGACCACGTGGAGGTCATCA
TGGCCATGGAGGACGAGTTCGGTTTCGAGATCCCCGACTCTGATGCCGAG
AAGCTGCTTAAACCTGCCGACATTATTAAGTACGTCGCCGACAAGGAGGA
TGTGTACGAGTAAATTGTAATTGTAATGCAAGCCATTGAACGGATTACAC
TTAAATTTAAATAGAAAACAAGTCAAATACAATTTGATCAACTGAATAAA
AAAAAAAAAAAAA

RE40155.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:34:28
Subject Length Description Subject Range Query Range Score Percent Strand
mtacp1-RA 931 mtacp1-RA 199..798 1..600 3000 100 Plus
mtacp1.a 972 mtacp1.a 488..885 203..600 1990 100 Plus
mtacp1-RB 904 mtacp1-RB 502..771 331..600 1350 100 Plus
mtacp1.a 972 mtacp1.a 199..406 1..208 1025 99.5 Plus
mtacp1-RB 904 mtacp1-RB 199..406 1..208 1025 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:18:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1330790..1331055 332..597 1330 100 Plus
chr3L 24539361 chr3L 1329643..1329803 45..205 805 100 Plus
chr3L 24539361 chr3L 1330550..1330689 201..340 655 97.9 Plus
chr3L 24539361 chr3L 1329516..1329560 1..45 225 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:54:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:18:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1331278..1331546 332..600 1345 100 Plus
3L 28110227 3L 1330131..1330291 45..205 805 100 Plus
3L 28110227 3L 1331038..1331177 201..340 655 97.9 Plus
3L 28110227 3L 1330004..1330048 1..45 225 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:51:23
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1331278..1331546 332..600 1345 100 Plus
3L 28103327 3L 1330131..1330291 45..205 805 100 Plus
3L 28103327 3L 1331038..1331177 201..340 655 97.8 Plus
3L 28103327 3L 1330004..1330048 1..45 225 100 Plus
Blast to na_te.dros performed 2019-03-15 17:18:15
Subject Length Description Subject Range Query Range Score Percent Strand
X-element 4740 X-element ROXELEMENT 4740bp 3462..3553 409..500 117 61.3 Plus

RE40155.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:19:05 Download gff for RE40155.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1329516..1329559 1..44 100 -> Plus
chr3L 1329643..1329802 45..204 100 -> Plus
chr3L 1330554..1330682 205..333 100 -> Plus
chr3L 1330792..1331055 334..597 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-18 09:36:48 Download gff for RE40155.complete
Subject Subject Range Query Range Percent Splice Strand
mtacp1-RA 1..459 55..513 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:52:50 Download gff for RE40155.complete
Subject Subject Range Query Range Percent Splice Strand
mtacp1-RA 1..459 55..513 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:31:53 Download gff for RE40155.complete
Subject Subject Range Query Range Percent Splice Strand
mtacp1-RA 1..459 55..513 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:33:25 Download gff for RE40155.complete
Subject Subject Range Query Range Percent Splice Strand
mtacp1-RA 1..459 55..513 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-18 09:36:48 Download gff for RE40155.complete
Subject Subject Range Query Range Percent Splice Strand
mtacp1-RA 199..795 1..597 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:52:50 Download gff for RE40155.complete
Subject Subject Range Query Range Percent Splice Strand
mtacp1-RA 199..795 1..597 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:31:53 Download gff for RE40155.complete
Subject Subject Range Query Range Percent Splice Strand
mtacp1-RA 56..652 1..597 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:33:25 Download gff for RE40155.complete
Subject Subject Range Query Range Percent Splice Strand
mtacp1-RA 56..652 1..597 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:19:05 Download gff for RE40155.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1330004..1330047 1..44 100 -> Plus
3L 1330131..1330290 45..204 100 -> Plus
3L 1331042..1331170 205..333 100 -> Plus
3L 1331280..1331543 334..597 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:19:05 Download gff for RE40155.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1330004..1330047 1..44 100 -> Plus
3L 1330131..1330290 45..204 100 -> Plus
3L 1331042..1331170 205..333 100 -> Plus
3L 1331280..1331543 334..597 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:19:05 Download gff for RE40155.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1330004..1330047 1..44 100 -> Plus
3L 1330131..1330290 45..204 100 -> Plus
3L 1331042..1331170 205..333 100 -> Plus
3L 1331280..1331543 334..597 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:31:53 Download gff for RE40155.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1331042..1331170 205..333 100 -> Plus
arm_3L 1330004..1330047 1..44 100 -> Plus
arm_3L 1330131..1330290 45..204 100 -> Plus
arm_3L 1331280..1331543 334..597 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:29:04 Download gff for RE40155.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1331280..1331543 334..597 100   Plus
3L 1330004..1330047 1..44 100 -> Plus
3L 1330131..1330290 45..204 100 -> Plus
3L 1331042..1331170 205..333 100 -> Plus

RE40155.hyp Sequence

Translation from 0 to 512

> RE40155.hyp
LFLAPALLHNLENSARTEMSFTQIARSCSRLAATLAPRRVASGILIQSQA
SRMMHRIAVPSMTSQLSQECRGRWQTQLVRRYSAKPPLSLKLINERVLLV
LKLYDKIDPSKLNVESHFINDLGLDSLDHVEVIMAMEDEFGFEIPDSDAE
KLLKPADIIKYVADKEDVYE*

RE40155.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:08:04
Subject Length Description Subject Range Query Range Score Percent Strand
mtacp1-PA 152 CG9160-PA 1..152 19..170 761 100 Plus
mtacp1-PC 181 CG9160-PC 1..181 19..170 721 84 Plus
mtacp1-PB 143 CG9160-PB 1..143 19..170 572 81.6 Plus

RE40155.pep Sequence

Translation from 0 to 512

> RE40155.pep
LFLAPALLHNLENSARTEMSFTQIARSCSRLAATLAPRRVASGILIQSQA
SRMMHRIAVPSMTSQLSQECRGRWQTQLVRRYSAKPPLSLKLINERVLLV
LKLYDKIDPSKLNVESHFINDLGLDSLDHVEVIMAMEDEFGFEIPDSDAE
KLLKPADIIKYVADKEDVYE*

RE40155.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:26:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24455-PA 185 GF24455-PA 1..185 19..170 678 72 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:26:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14782-PA 186 GG14782-PA 1..186 19..170 751 79 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:26:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15216-PA 184 GH15216-PA 1..184 19..170 619 68.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:05:42
Subject Length Description Subject Range Query Range Score Percent Strand
ND-ACP-PA 152 CG9160-PA 1..152 19..170 761 100 Plus
ND-ACP-PC 181 CG9160-PC 1..181 19..170 721 84 Plus
ND-ACP-PB 143 CG9160-PB 1..143 19..170 572 81.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:26:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11927-PA 186 GI11927-PA 1..186 19..170 606 66.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:26:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16180-PA 189 GL16180-PA 1..189 19..170 623 65.6 Plus
Dper\GL21696-PA 143 GL21696-PA 1..143 19..170 519 67.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:26:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21583-PA 189 GA21583-PA 1..189 19..170 638 67.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:26:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14402-PA 186 GM14402-PA 1..186 19..170 762 81.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:26:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13611-PA 186 GD13611-PA 1..186 19..170 762 81.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:26:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12150-PA 184 GJ12150-PA 1..184 19..170 619 67.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:26:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13357-PA 181 GK13357-PA 1..181 19..170 583 66.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:26:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\mtacp1-PA 186 GE21146-PA 1..186 19..170 761 81.2 Plus