Clone RE40159 Report

Search the DGRC for RE40159

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:401
Well:59
Vector:pFlc-1
Associated Gene/TranscriptCG13704-RA
Protein status:RE40159.pep: gold
Preliminary Size:423
Sequenced Size:699

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13704 2002-01-01 Sim4 clustering to Release 2
CG13704 2002-02-22 Blastp of sequenced clone
CG13704 2003-01-01 Sim4 clustering to Release 3
CG13704 2008-04-29 Release 5.5 accounting
CG13704 2008-08-15 Release 5.9 accounting
CG13704 2008-12-18 5.12 accounting

Clone Sequence Records

RE40159.complete Sequence

699 bp (699 high quality bases) assembled on 2002-02-22

GenBank Submission: AY084166

> RE40159.complete
AGTTCCACTTTGGAGTCGACGACGTGCGCGTTACAAACTTGGCTAACAGC
TAAAAGCGAACATAAGTTTTTTCGAAAGAACCGACGAAAACGACGGAAAT
GAAGTTGGCTAAGAAGTGCTCCACCTACTTGGTGATATGCCTGGTACTGT
TGGCCTGCTGCCTGCAAGAATCGGAGGCCACGCGACGTGTGAACCGCGGA
CGACGCACCCTTACCCGCAGATACTTCACTGGCCTTGCTATTCCCGGATG
GGCTCTCATCGTTTGTGTAGCGGTAGGTGAGCTGCTGATTGGTGGAGCCC
TCTACTTCATCCTCAAGAAGGTGATCCTGGACAAGGAACCAGATCAGACG
GCGGCCTCCTACACGCCCGCCCAGACTCATGCGACGGCCACACCTTATAC
TCCCGCCCAGACTCACGATCCGGCCACGGCCACAACCTATACTCCTGCCC
AGACTCATGAGACGGCCAATGTGACTCCCACTCCAACGCATGCCACCGCT
ATTGTCTGAGGAGATGTGTACAGATCCAAGTGACCACTTTTGGTTCATAA
CCCTTTCCAAATCAGTTCAAATTCCACCATTAACTAGCTTTATTGTCATT
TAATCGACACACAAATAGAACCTGTGCCCTTTGTCTACCTTCATTTTCGA
ATAAAATTATTTGCCACTTATCTGGCGCCAAACCAAAAAAAAAAAAAAA

RE40159.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:25:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG13704-RA 857 CG13704-RA 50..731 1..683 3375 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:47:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 4899886..4900341 229..683 2185 99.1 Plus
chr3L 24539361 chr3L 4898360..4898503 1..144 720 100 Plus
chr3L 24539361 chr3L 4899747..4899831 144..228 425 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:54:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:47:21
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4900415..4900869 229..683 2275 100 Plus
3L 28110227 3L 4898900..4899042 1..144 670 99.3 Plus
3L 28110227 3L 4900276..4900360 144..228 425 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:54:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 4900415..4900869 229..683 2275 100 Plus
3L 28103327 3L 4898900..4899042 1..144 680 99.3 Plus
3L 28103327 3L 4900276..4900360 144..228 425 100 Plus
Blast to na_te.dros performed on 2019-03-16 19:47:21 has no hits.

RE40159.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:48:01 Download gff for RE40159.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 4898360..4898503 1..144 100 -> Plus
chr3L 4899748..4899831 145..228 100 -> Plus
chr3L 4899886..4900341 229..684 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:14:59 Download gff for RE40159.complete
Subject Subject Range Query Range Percent Splice Strand
CG13704-RA 1..411 99..509 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:37:38 Download gff for RE40159.complete
Subject Subject Range Query Range Percent Splice Strand
CG13704-RA 1..411 99..509 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:47:53 Download gff for RE40159.complete
Subject Subject Range Query Range Percent Splice Strand
CG13704-RA 1..411 99..509 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:08:24 Download gff for RE40159.complete
Subject Subject Range Query Range Percent Splice Strand
CG13704-RA 1..411 99..509 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:42:58 Download gff for RE40159.complete
Subject Subject Range Query Range Percent Splice Strand
CG13704-RA 1..411 99..509 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:02:53 Download gff for RE40159.complete
Subject Subject Range Query Range Percent Splice Strand
CG13704-RA 1..682 1..683 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:37:38 Download gff for RE40159.complete
Subject Subject Range Query Range Percent Splice Strand
CG13704-RA 1..682 1..683 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:47:53 Download gff for RE40159.complete
Subject Subject Range Query Range Percent Splice Strand
CG13704-RA 1..682 1..683 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:08:25 Download gff for RE40159.complete
Subject Subject Range Query Range Percent Splice Strand
CG13704-RA 1..682 1..683 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:42:58 Download gff for RE40159.complete
Subject Subject Range Query Range Percent Splice Strand
CG13704-RA 1..682 1..683 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:48:01 Download gff for RE40159.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4898900..4899042 1..144 99 -> Plus
3L 4900277..4900360 145..228 100 -> Plus
3L 4900415..4900869 229..684 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:48:01 Download gff for RE40159.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4898900..4899042 1..144 99 -> Plus
3L 4900277..4900360 145..228 100 -> Plus
3L 4900415..4900869 229..684 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:48:01 Download gff for RE40159.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4898900..4899042 1..144 99 -> Plus
3L 4900277..4900360 145..228 100 -> Plus
3L 4900415..4900869 229..684 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:47:53 Download gff for RE40159.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4898900..4899042 1..144 99 -> Plus
arm_3L 4900277..4900360 145..228 100 -> Plus
arm_3L 4900415..4900869 229..684 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:42:29 Download gff for RE40159.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4900415..4900869 229..684 99   Plus
3L 4898900..4899042 1..144 99 -> Plus
3L 4900277..4900360 145..228 100 -> Plus

RE40159.pep Sequence

Translation from 98 to 508

> RE40159.pep
MKLAKKCSTYLVICLVLLACCLQESEATRRVNRGRRTLTRRYFTGLAIPG
WALIVCVAVGELLIGGALYFILKKVILDKEPDQTAASYTPAQTHATATPY
TPAQTHDPATATTYTPAQTHETANVTPTPTHATAIV*

RE40159.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:00:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25096-PA 124 GF25096-PA 1..123 1..135 519 78.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:00:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15252-PA 136 GG15252-PA 1..136 1..136 686 97.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:00:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15701-PA 161 GH15701-PA 1..104 1..118 381 70.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG13704-PA 136 CG13704-PA 1..136 1..136 709 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:00:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12754-PA 129 GI12754-PA 1..128 1..135 412 63.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:00:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18658-PA 126 GL18658-PA 1..87 1..87 423 86.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:00:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12471-PA 126 GA12471-PA 1..87 1..87 423 86.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:00:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14685-PA 136 GM14685-PA 1..136 1..136 688 97.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:00:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13868-PA 136 GD13868-PA 1..136 1..136 691 97.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:00:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15522-PA 130 GJ15522-PA 1..129 1..135 395 64.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:00:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16604-PA 108 GK16604-PA 1..101 1..102 436 80.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:00:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21472-PA 136 GE21472-PA 1..136 1..136 684 96.3 Plus

RE40159.hyp Sequence

Translation from 98 to 508

> RE40159.hyp
MKLAKKCSTYLVICLVLLACCLQESEATRRVNRGRRTLTRRYFTGLAIPG
WALIVCVAVGELLIGGALYFILKKVILDKEPDQTAASYTPAQTHATATPY
TPAQTHDPATATTYTPAQTHETANVTPTPTHATAIV*

RE40159.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:39:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG13704-PA 136 CG13704-PA 1..136 1..136 709 100 Plus