Clone RE40431 Report

Search the DGRC for RE40431

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:404
Well:31
Vector:pFlc-1
Associated Gene/TranscriptCG13060-RA
Protein status:RE40431.pep: gold
Preliminary Size:396
Sequenced Size:550

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13060 2001-12-14 Blastp of sequenced clone
CG13060 2002-01-01 Sim4 clustering to Release 2
CG13060 2003-01-01 Sim4 clustering to Release 3
CG13060 2008-04-29 Release 5.5 accounting
CG13060 2008-08-15 Release 5.9 accounting
CG13060 2008-12-18 5.12 accounting

Clone Sequence Records

RE40431.complete Sequence

550 bp (550 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071377

> RE40431.complete
ATCAGTTACCTTACGAATCTTCTCACGCAATCAGCAGCACTCGCTTTAAA
GATACCAATATCAAAATGTTCAAATTTATCGGCGTCATCGCTCTCCTGGT
CGCCACCGCCAGTGCTGGTCTCATCGAGACTCACCATGTGGTGCACGAGC
CCGTTCTGGCCAAGGTTGGATCGGTGGTGCACTCTGCTCCCTCGGCGGTT
TCCCACCAGAGCATCACCCAGGTGCACAGCAAGGCGGTGGTGCAGCCAGT
GGTTGCTCCTATCGTGAAGACCACCACCTACTCCCATCCCGCCGTTGCCG
TCCATGCTGCTCCAGTGGTTCACTCCGTGCCCGTTGTCCACGCCGCTCCT
GTCGTCCACTCCGTTCACTCCGCTCCTGTGGTGCACTCGGTGCTTCACTC
CGCTCCCCTCGTCAAGTCAGTGGTGCACTCCGCTCCTCTGGCCTACACCC
TGCACCACTAAAGCGTTCAAATTGTTTGTTTGTTAACCAATTATATGAAA
ATAAAATAAAATTCTGAAAAGTATTATTGATCCGAAAAAAAAAAAAAAAA

RE40431.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:57:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG13060-RA 723 CG13060-RA 152..688 1..537 2670 99.8 Plus
CG13041-RA 757 CG13041-RA 269..569 61..361 1385 97.3 Plus
CG13041-RA 757 CG13041-RA 583..648 396..461 285 95.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:30:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16309748..16310203 78..533 2190 98.7 Plus
chr3L 24539361 chr3L 16308775..16309131 461..84 1325 91.3 Minus
chr3L 24539361 chr3L 16309611..16309684 1..74 355 98.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:55:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:30:04
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16319998..16320457 78..537 2285 99.8 Plus
3L 28110227 3L 16319025..16319381 461..84 1355 91.8 Minus
3L 28110227 3L 16319861..16319937 1..77 385 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:16:17
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16313098..16313557 78..537 2285 99.7 Plus
3L 28103327 3L 16312204..16312481 361..84 1345 98.9 Minus
3L 28103327 3L 16312961..16313037 1..77 385 100 Plus
3L 28103327 3L 16312125..16312190 461..396 285 95.4 Minus
Blast to na_te.dros performed on 2019-03-16 03:30:04 has no hits.

RE40431.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:30:50 Download gff for RE40431.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16309611..16309687 1..77 97 -> Plus
chr3L 16309748..16310203 78..534 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:15:11 Download gff for RE40431.complete
Subject Subject Range Query Range Percent Splice Strand
CG13060-RA 1..396 66..461 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:55:52 Download gff for RE40431.complete
Subject Subject Range Query Range Percent Splice Strand
CG13060-RA 1..396 66..461 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:46:15 Download gff for RE40431.complete
Subject Subject Range Query Range Percent Splice Strand
CG13060-RA 1..396 66..461 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:38:28 Download gff for RE40431.complete
Subject Subject Range Query Range Percent Splice Strand
CG13060-RA 1..396 66..461 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:07:41 Download gff for RE40431.complete
Subject Subject Range Query Range Percent Splice Strand
CG13060-RA 1..396 66..461 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:09:26 Download gff for RE40431.complete
Subject Subject Range Query Range Percent Splice Strand
CG13060-RA 1..533 1..534 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:55:52 Download gff for RE40431.complete
Subject Subject Range Query Range Percent Splice Strand
CG13060-RA 2..534 1..534 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:46:15 Download gff for RE40431.complete
Subject Subject Range Query Range Percent Splice Strand
CG13060-RA 6..538 1..534 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:38:28 Download gff for RE40431.complete
Subject Subject Range Query Range Percent Splice Strand
CG13060-RA 1..533 1..534 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:07:41 Download gff for RE40431.complete
Subject Subject Range Query Range Percent Splice Strand
CG13060-RA 6..538 1..534 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:30:50 Download gff for RE40431.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16319861..16319937 1..77 100 -> Plus
3L 16319998..16320453 78..534 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:30:50 Download gff for RE40431.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16319861..16319937 1..77 100 -> Plus
3L 16319998..16320453 78..534 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:30:50 Download gff for RE40431.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16319861..16319937 1..77 100 -> Plus
3L 16319998..16320453 78..534 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:46:15 Download gff for RE40431.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16312961..16313037 1..77 100 -> Plus
arm_3L 16313098..16313553 78..534 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:21:28 Download gff for RE40431.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16313098..16313553 78..534 99   Plus
3L 16312961..16313037 1..77 100 -> Plus

RE40431.hyp Sequence

Translation from 2 to 460

> RE40431.hyp
QLPYESSHAISSTRFKDTNIKMFKFIGVIALLVATASAGLIETHHVVHEP
VLAKVGSVVHSAPSAVSHQSITQVHSKAVVQPVVAPIVKTTTYSHPAVAV
HAAPVVHSVPVVHAAPVVHSVHSAPVVHSVLHSAPLVKSVVHSAPLAYTL
HH*

RE40431.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:52:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG13060-PA 131 CG13060-PA 1..131 22..152 659 100 Plus
CG13041-PA 124 CG13041-PA 1..124 22..152 584 90.8 Plus
CG13044-PA 155 CG13044-PA 1..150 22..148 261 47.3 Plus
CG13040-PB 185 CG13040-PB 1..144 22..152 249 45.9 Plus
CG13040-PA 185 CG13040-PA 1..144 22..152 249 45.9 Plus

RE40431.pep Sequence

Translation from 65 to 460

> RE40431.pep
MFKFIGVIALLVATASAGLIETHHVVHEPVLAKVGSVVHSAPSAVSHQSI
TQVHSKAVVQPVVAPIVKTTTYSHPAVAVHAAPVVHSVPVVHAAPVVHSV
HSAPVVHSVLHSAPLVKSVVHSAPLAYTLHH*

RE40431.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:29:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24181-PA 136 GF24181-PA 1..136 1..131 404 81.3 Plus
Dana\GF10296-PA 136 GF10296-PA 1..136 1..131 317 78.7 Plus
Dana\GF24178-PA 138 GF24178-PA 1..128 1..119 197 49.6 Plus
Dana\GF10297-PA 112 GF10297-PA 1..96 1..87 175 43.9 Plus
Dana\GF10298-PA 145 GF10298-PA 33..140 22..128 148 50 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:29:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15985-PA 136 GG15985-PA 1..136 1..131 425 82.4 Plus
Dere\GG13467-PA 136 GG13467-PA 1..136 1..131 393 65.8 Plus
Dere\GG13469-PA 117 GG13469-PA 1..96 1..87 181 45.9 Plus
Dere\GG13471-PA 155 GG13471-PA 33..145 22..131 175 54.5 Plus
Dere\GG15987-PA 157 GG15987-PA 1..135 1..129 168 43 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:29:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15877-PA 123 GH15877-PA 1..123 1..131 349 65 Plus
Dgri\GH15606-PA 114 GH15606-PA 1..114 1..131 326 65.6 Plus
Dgri\GH15608-PA 163 GH15608-PA 33..158 22..128 178 52 Plus
Dgri\GH15607-PA 111 GH15607-PA 35..96 25..87 162 56.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:07:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG13060-PA 131 CG13060-PA 1..131 1..131 659 100 Plus
CG13041-PA 124 CG13041-PA 1..124 1..131 584 90.8 Plus
CG13044-PA 155 CG13044-PA 1..150 1..127 261 47.3 Plus
CG13040-PB 185 CG13040-PB 1..144 1..131 249 45.9 Plus
CG13040-PA 185 CG13040-PA 1..144 1..131 249 45.9 Plus
CG13059-PA 155 CG13059-PA 1..144 1..130 221 44.5 Plus
CG13043-PA 148 CG13043-PA 1..143 1..128 212 48.3 Plus
CG13042-PA 117 CG13042-PA 1..96 1..87 202 45.9 Plus
CG13063-PA 129 CG13063-PA 1..124 1..116 190 46.9 Plus
CG4962-PA 123 CG4962-PA 1..95 1..99 144 36.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:29:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16526-PA 111 GI16526-PA 1..111 1..131 303 66.4 Plus
Dmoj\GI12653-PA 111 GI12653-PA 1..111 1..131 303 66.4 Plus
Dmoj\GI12659-PA 111 GI12659-PA 1..111 1..131 301 65.6 Plus
Dmoj\GI16882-PA 111 GI16882-PA 1..111 1..131 301 65.6 Plus
Dmoj\GI16883-PA 112 GI16883-PA 35..96 25..87 158 56.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:29:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18008-PA 125 GL18008-PA 1..125 1..131 347 68.2 Plus
Dper\GL17851-PA 135 GL17851-PA 1..135 1..131 329 66.7 Plus
Dper\GL18009-PA 110 GL18009-PA 35..94 27..87 167 58.1 Plus
Dper\GL18007-PA 185 GL18007-PA 1..117 1..108 152 49.2 Plus
Dper\GL18011-PA 152 GL18011-PA 35..123 25..128 149 50 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:29:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28363-PA 125 GA28363-PA 1..125 1..131 344 67.4 Plus
Dpse\GA28513-PA 135 GA28513-PA 1..135 1..131 337 67.4 Plus
Dpse\GA11996-PA 110 GA11996-PA 35..94 27..87 167 58.1 Plus
Dpse\GA12011-PA 157 GA12011-PA 19..156 18..131 165 44.2 Plus
Dpse\GA11994-PA 191 GA11994-PA 1..117 1..108 152 49.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:29:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25617-PA 136 GM25617-PA 1..136 1..131 392 67.1 Plus
Dsec\GM24416-PA 136 GM24416-PA 1..136 1..131 389 66.5 Plus
Dsec\GM24418-PA 117 GM24418-PA 1..96 1..87 183 45.9 Plus
Dsec\GM24415-PA 185 GM24415-PA 1..130 1..116 183 46.6 Plus
Dsec\GM24420-PA 155 GM24420-PA 33..145 22..131 175 54.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:29:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14622-PA 133 GD14622-PA 1..133 1..131 428 96.2 Plus
Dsim\GD12487-PA 136 GD12487-PA 1..136 1..131 392 67.1 Plus
Dsim\GD12488-PA 117 GD12488-PA 1..96 1..87 183 45.9 Plus
Dsim\GD12485-PA 185 GD12485-PA 1..121 1..107 182 48.4 Plus
Dsim\GD12490-PA 155 GD12490-PA 33..145 22..131 175 54.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:29:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12631-PA 123 GJ12631-PA 1..123 1..131 362 68.4 Plus
Dvir\GJ12779-PA 115 GJ12779-PA 1..115 1..131 350 72.5 Plus
Dvir\GJ12633-PA 170 GJ12633-PA 36..165 25..128 159 45.5 Plus
Dvir\GJ12632-PA 113 GJ12632-PA 36..97 25..87 158 54.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:29:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16560-PA 128 GK16560-PA 1..128 1..131 297 63.7 Plus
Dwil\GK17640-PA 128 GK17640-PA 1..128 1..131 254 63 Plus
Dwil\GK17643-PA 148 GK17643-PA 38..146 26..130 181 46.6 Plus
Dwil\GK17641-PA 115 GK17641-PA 36..98 25..87 176 59.4 Plus
Dwil\GK17642-PA 147 GK17642-PA 38..142 25..128 139 53.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:29:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19548-PA 136 GE19548-PA 1..136 1..131 393 67.1 Plus
Dyak\GE23111-PA 136 GE23111-PA 1..136 1..131 388 66.5 Plus
Dyak\GE22898-PA 140 GE22898-PA 9..140 5..131 362 65.6 Plus
Dyak\GE22801-PA 117 GE22801-PA 1..96 1..87 181 45.9 Plus
Dyak\GE22804-PA 155 GE22804-PA 29..145 18..131 181 54.4 Plus