Clone RE40480 Report

Search the DGRC for RE40480

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:404
Well:80
Vector:pFlc-1
Associated Gene/TranscriptDip3-RA
Protein status:RE40480.pep: gold
Preliminary Size:1452
Sequenced Size:1447

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12767 2001-12-14 Blastp of sequenced clone
CG12767 2002-01-01 Sim4 clustering to Release 2
CG12767 2003-01-01 Sim4 clustering to Release 3
Dip3 2008-04-29 Release 5.5 accounting
Dip3 2008-08-15 Release 5.9 accounting
Dip3 2008-12-18 5.12 accounting

Clone Sequence Records

RE40480.complete Sequence

1447 bp (1447 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071378

> RE40480.complete
GTAAATCGGTCGCAGCAACATAAACTTTTAGAATCGCCAGCGAGAGCCGT
CTTAAAAGTGCGAATACAAACAGAAGGAAAAGCGGCCGCCTATGGCAACC
TGACTAGCAAAACATTCGAAAGCAATTGGCCAAAGTTAGGACGAAATGAG
CCGAAAGAACGGAAACCAGGACACCTTTCCCAAGACGGAGAAGATGCAGC
GCTACTACGCGGAGCGCGAGACCACAGGACCCGAGTTCGACGATCGCCTG
ATAAAGCTTGTGCGCGCCAATCCGGCCATCTATGATGTCAGCCATCCGCA
CTATCGCCGTAATCCGGTGCGGGTGGACATATGGGATCGCATTGCCAACG
AACTGGGCGCCTCCTCCCGATTTCTGCAAACCAAATGGAAGAACATACGA
TACAACTATCTGCAGGAGGTCAAGGCGATTGAGACGGGCCAGGCGAATCC
GAACGTACGCAAGCGGCGCTTCACTGAGGATCTATCCTTTCTGCAGAACA
CGGCCCAAACCTACAATGTGAAGAAATCCCAGAGCTACGTGGCCCAACAG
AATGGAATGGGAAGTGACAACGACAGCAATAGCTTTTTGTATCCCGATCC
GGAGCACCTAAAGATCGACGCCTCCGAGGGCTACGACATCATCGAGCTGG
ACAACAGCGACGATGGCTCAAATAGCGACGACAACGAGATTGTGCCCGAG
TTGCAGCTGGTCATGGGAGAGTCCAAGCAGCAATTATCCCTGCCGACGAC
ACTGAACGGCACCAGCAGCAGCAATCACAGCCACGAACATGACCAAGCCA
GCTCGCCGGCCTCCTCGCCCCTGCTAACGCCGATGGTTGTAATGGGCAAT
GGCTATGGCCAGGAGGTGCATCTAGAACAGCAGCAGACACAGGAGCAAAA
GCCGTTCAAGAATAGCTCGCTGTCCAACGGAGAAGTGACCATTGAGCCCA
TTTACAAGCCTGCGGCTATCAGACGCGCATTACCCAGCGATTTTCTGACC
AATCCCTTCAAGCGCAAGGCAACCCAAGCGCCGCTTCAGACCCAAGTGAC
GTCGTCCTTCAACGATCCCATCGAGCTCTACTGCCTATCGCTGGTGGACA
CACTGCGCAGCATGCGGAGATCGGAACGGGAGCGGGTCAAGTTCGAGTTC
GCCAACATTCTGAAGGACGCCAAGTACAAGGACGAAAGCTAAGGCGTCAT
AGTCATCATTCTATACGTACAATTCTCGATTAGTATCCTTAGTGGTAGAC
AACGCACTCGAACACTTCCCACACTCCCCCTTCATTTATGTATTTACATA
CTTGCAAACAACTTGTAACTCTACGTTTCGAGTCCTAGGCTAAGGTTCTA
GGTTAATTTGAGGCGATATGTGTCCATAGTCCATATCTCTTTAGTTGTAT
CAACATTGAGTCGAATAAAATTATGCACAAAACAAAAAAAAAAAAAA

RE40480.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:39:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dip3-RA 1680 Dip3-RA 239..1673 1..1435 7175 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:19:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14016295..14017362 366..1433 5190 99.1 Plus
chr2R 21145070 chr2R 14015648..14015886 1..239 1195 100 Plus
chr2R 21145070 chr2R 14016091..14016217 239..365 635 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:55:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:19:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18129179..18130248 366..1435 5350 100 Plus
2R 25286936 2R 18128532..18128770 1..239 1195 100 Plus
2R 25286936 2R 18128975..18129101 239..365 635 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:06:59
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18130378..18131447 366..1435 5350 100 Plus
2R 25260384 2R 18129731..18129969 1..239 1195 100 Plus
2R 25260384 2R 18130174..18130300 239..365 635 100 Plus
Blast to na_te.dros performed 2019-03-16 12:19:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2328..2385 860..916 116 69 Plus
roo 9092 roo DM_ROO 9092bp 1064..1121 860..916 116 69 Plus

RE40480.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:20:54 Download gff for RE40480.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14015648..14015886 1..239 100 -> Plus
chr2R 14016092..14016217 240..365 100 -> Plus
chr2R 14016295..14017362 366..1433 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:15:14 Download gff for RE40480.complete
Subject Subject Range Query Range Percent Splice Strand
Dip3-RA 1..1047 146..1192 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:04:16 Download gff for RE40480.complete
Subject Subject Range Query Range Percent Splice Strand
Dip3-RA 1..1047 146..1192 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:11:10 Download gff for RE40480.complete
Subject Subject Range Query Range Percent Splice Strand
Dip3-RA 1..1047 146..1192 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:28:58 Download gff for RE40480.complete
Subject Subject Range Query Range Percent Splice Strand
Dip3-RA 1..1047 146..1192 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:43:36 Download gff for RE40480.complete
Subject Subject Range Query Range Percent Splice Strand
Dip3-RA 1..1047 146..1192 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:31:42 Download gff for RE40480.complete
Subject Subject Range Query Range Percent Splice Strand
Dip3-RA 33..1465 1..1433 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:04:16 Download gff for RE40480.complete
Subject Subject Range Query Range Percent Splice Strand
Dip3-RA 33..1465 1..1433 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:11:10 Download gff for RE40480.complete
Subject Subject Range Query Range Percent Splice Strand
Dip3-RA 39..1471 1..1433 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:28:58 Download gff for RE40480.complete
Subject Subject Range Query Range Percent Splice Strand
Dip3-RA 33..1465 1..1433 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:43:36 Download gff for RE40480.complete
Subject Subject Range Query Range Percent Splice Strand
Dip3-RA 39..1471 1..1433 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:20:54 Download gff for RE40480.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18128532..18128770 1..239 100 -> Plus
2R 18128976..18129101 240..365 100 -> Plus
2R 18129179..18130246 366..1433 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:20:54 Download gff for RE40480.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18128532..18128770 1..239 100 -> Plus
2R 18128976..18129101 240..365 100 -> Plus
2R 18129179..18130246 366..1433 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:20:54 Download gff for RE40480.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18128532..18128770 1..239 100 -> Plus
2R 18128976..18129101 240..365 100 -> Plus
2R 18129179..18130246 366..1433 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:11:10 Download gff for RE40480.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14016037..14016275 1..239 100 -> Plus
arm_2R 14016481..14016606 240..365 100 -> Plus
arm_2R 14016684..14017751 366..1433 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:04:53 Download gff for RE40480.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18129731..18129969 1..239 100 -> Plus
2R 18130175..18130300 240..365 100 -> Plus
2R 18130378..18131445 366..1433 100   Plus

RE40480.hyp Sequence

Translation from 145 to 1191

> RE40480.hyp
MSRKNGNQDTFPKTEKMQRYYAERETTGPEFDDRLIKLVRANPAIYDVSH
PHYRRNPVRVDIWDRIANELGASSRFLQTKWKNIRYNYLQEVKAIETGQA
NPNVRKRRFTEDLSFLQNTAQTYNVKKSQSYVAQQNGMGSDNDSNSFLYP
DPEHLKIDASEGYDIIELDNSDDGSNSDDNEIVPELQLVMGESKQQLSLP
TTLNGTSSSNHSHEHDQASSPASSPLLTPMVVMGNGYGQEVHLEQQQTQE
QKPFKNSSLSNGEVTIEPIYKPAAIRRALPSDFLTNPFKRKATQAPLQTQ
VTSSFNDPIELYCLSLVDTLRSMRRSERERVKFEFANILKDAKYKDES*

RE40480.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:08:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dip3-PA 348 CG12767-PA 1..348 1..348 1807 100 Plus

RE40480.pep Sequence

Translation from 145 to 1191

> RE40480.pep
MSRKNGNQDTFPKTEKMQRYYAERETTGPEFDDRLIKLVRANPAIYDVSH
PHYRRNPVRVDIWDRIANELGASSRFLQTKWKNIRYNYLQEVKAIETGQA
NPNVRKRRFTEDLSFLQNTAQTYNVKKSQSYVAQQNGMGSDNDSNSFLYP
DPEHLKIDASEGYDIIELDNSDDGSNSDDNEIVPELQLVMGESKQQLSLP
TTLNGTSSSNHSHEHDQASSPASSPLLTPMVVMGNGYGQEVHLEQQQTQE
QKPFKNSSLSNGEVTIEPIYKPAAIRRALPSDFLTNPFKRKATQAPLQTQ
VTSSFNDPIELYCLSLVDTLRSMRRSERERVKFEFANILKDAKYKDES*

RE40480.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:32:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12650-PA 342 GF12650-PA 8..342 16..348 1347 79.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:32:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21844-PA 348 GG21844-PA 1..348 1..348 1674 89.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:32:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21050-PA 368 GH21050-PA 5..368 16..348 1160 67 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:18:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dlip3-PA 348 CG12767-PA 1..348 1..348 1807 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:32:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18651-PA 362 GI18651-PA 1..362 17..348 1130 65.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:32:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11546-PA 326 GL11546-PA 1..326 17..348 1276 78.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:32:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11800-PA 326 GA11800-PA 1..326 17..348 1279 78.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:32:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21845-PA 267 GM21845-PA 34..267 115..348 1054 92.3 Plus
Dsec\GM21845-PA 267 GM21845-PA 1..31 1..31 166 93.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:32:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11339-PA 348 GD11339-PA 1..348 1..348 1704 96 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:32:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21668-PA 346 GJ21668-PA 1..346 17..348 1194 70 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:32:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19649-PA 391 GK19649-PA 1..391 17..348 1103 61 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:32:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11923-PA 348 GE11923-PA 1..348 1..348 1680 90.2 Plus