Clone RE40740 Report

Search the DGRC for RE40740

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:407
Well:40
Vector:pFlc-1
Associated Gene/Transcriptgfzf-RD
Protein status:RE40740.pep: gold
Sequenced Size:1219

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG33546 2004-03-31 Blastp of sequenced clone
gfzf 2008-04-29 Release 5.5 accounting
gfzf 2008-08-15 Release 5.9 accounting
gfzf 2008-12-18 5.12 accounting

Clone Sequence Records

RE40740.complete Sequence

1219 bp (1219 high quality bases) assembled on 2004-03-31

GenBank Submission: BT012465

> RE40740.complete
TCTGTATGGTTTGAAAGCTGCTCGAACGTACAACATTAATTTTGGACCCA
TCTACACAATGAAACTCTACGCCGTATCCGATGGTCCGCCTTCCCTGGCC
GTTCGCATGACCCTGAAGGCCTTGGATATACAATATCAACTCATCAATGT
GGACTTTTGCGCCATGGAACATCGCTCTGAGGAGTACTCGAAGATGAATC
CGCAAAAGGAGATACCCGTGCTGGACGACGACGGTTTCTATCTATCGGAG
AGCATTGCCATTATGCAATACCTCTGCGACAAGTACGCGCCGGATTCAAC
GCTATATCCGCAGGACGTCAATGTGAGAGCAGTAATCAATCAGCGGCTAT
GCTTTAACATGGGATTCTACTATGCCCCCATATCCGCCCACAGCATGGCG
CCCATTTTCTTCGACTACAAACGTACGCCCATGTCGCTAAAGAAGGTGCA
GAACGCACTTGATGTGTTCGAAACCTATTTGCAGCGACTGGGCACTAAGT
ACGCGGCAGGCGAGAACATAACCATTGCAGACTTCGCTCTCATTTCGGCC
ACGATCTGCTTGGAGGCAATTAACTTTGACTTGCACCAGTTTACGTTGGT
GAACAAGTGGTACGAAACCTTCAAGGTGGAATACCCGCAGCTGTGGGAGA
TCGCCAACAGCGGCATGCAGGAGATAAGTGCGTTTGAGCAGAACCCACCG
GATATGTCACACATGGAACACCCATTCCATCCGACGCGCAAGTCTATGGG
CCTGAAGTTGTAGATTGTAGTTTTAGAACTTAAGACCCTGCCAGCAAGGG
AAGTGAAAAACGTTCTCCTTTTAATTCTTGTGAAATATTCGATATATATA
TATATATTGATATAATAATAATAACATAATTATATAATAATATATAATTA
TAGGTTGTTTTGCCTTCCAAATTGACATGAACAAAGAAGTTCAGAAGTCT
AAGAAAAAATAGTATTAAAATGTGCCCACAAAATTTTATGCGATTGAAAT
TGCAAGTCGAACTGGAGGTCAAGCTTAAATTTTTTCAACAAAATACATAT
TTCCATTATTTTTGTCTTATTAGAAAATATTATCATTTCTTGCTAACAAT
TTGAAGTTATTTTATGGCAAGAATCCCTTTAAATCAACCTTGGTTATTAT
AAGGACTAATCAACCTGTGTTTATCATTTAAAATAAAACATTTCGATAAA
AAAAAAAAAAAAAAAAAAA

RE40740.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:02:35
Subject Length Description Subject Range Query Range Score Percent Strand
gfzf-RD 1258 gfzf-RD 11..1215 4..1208 5995 99.8 Plus
gfzf-RB 3974 gfzf-RB 2765..3931 42..1208 5790 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:20:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2971942..2972947 1197..192 5015 99.9 Minus
chr3R 27901430 chr3R 2973007..2973155 193..45 730 99.3 Minus
chr3R 27901430 chr3R 2973400..2973441 45..4 210 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:55:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:20:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7145869..7146885 1208..192 5055 99.8 Minus
3R 32079331 3R 7146945..7147093 193..45 745 100 Minus
3R 32079331 3R 7147331..7147372 45..4 210 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:50:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6886700..6887716 1208..192 5055 99.8 Minus
3R 31820162 3R 6887776..6887924 193..45 745 100 Minus
3R 31820162 3R 6888162..6888203 45..4 210 100 Minus
Blast to na_te.dros performed 2019-03-16 12:20:15
Subject Length Description Subject Range Query Range Score Percent Strand
S-element 1736 S-element DM33463 1736bp Derived from U33463 (g1006788) (Rel. 47, Last updated, Version 5). 94..305 848..1070 130 57.8 Plus
hopper 1435 hopper DMTRDNA 1435bp Derived from X80025 (g510507) (Rel. 44, Last updated, Version 11). 1040..1213 1027..1196 113 55.1 Plus

RE40740.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:21:04 Download gff for RE40740.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2971942..2972236 903..1197 100 == Minus
chr3R 2972298..2972945 194..841 99 <- Minus
chr3R 2973007..2973154 46..193 99 <- Minus
chr3R 2973400..2973444 1..45 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:15:30 Download gff for RE40740.complete
Subject Subject Range Query Range Percent Splice Strand
gfzf-RB 2417..3138 42..763 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:37:54 Download gff for RE40740.complete
Subject Subject Range Query Range Percent Splice Strand
gfzf-RB 2417..3138 42..763 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:12:23 Download gff for RE40740.complete
Subject Subject Range Query Range Percent Splice Strand
gfzf-RB 2417..3138 42..763 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:21:42 Download gff for RE40740.complete
Subject Subject Range Query Range Percent Splice Strand
gfzf-RB 2417..3138 42..763 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:43:56 Download gff for RE40740.complete
Subject Subject Range Query Range Percent Splice Strand
gfzf-RB 2417..3138 42..763 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:45:45 Download gff for RE40740.complete
Subject Subject Range Query Range Percent Splice Strand
gfzf-RD 1..1197 1..1197 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:37:54 Download gff for RE40740.complete
Subject Subject Range Query Range Percent Splice Strand
gfzf-RD 1..1197 1..1197 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:12:23 Download gff for RE40740.complete
Subject Subject Range Query Range Percent Splice Strand
gfzf-RD 4..1200 1..1197 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:21:43 Download gff for RE40740.complete
Subject Subject Range Query Range Percent Splice Strand
gfzf-RD 1..1197 1..1197 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:43:56 Download gff for RE40740.complete
Subject Subject Range Query Range Percent Splice Strand
gfzf-RD 4..1200 1..1197 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:21:04 Download gff for RE40740.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7145880..7146883 194..1197 100 <- Minus
3R 7146945..7147092 46..193 100 <- Minus
3R 7147331..7147375 1..45 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:21:04 Download gff for RE40740.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7145880..7146883 194..1197 100 <- Minus
3R 7146945..7147092 46..193 100 <- Minus
3R 7147331..7147375 1..45 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:21:04 Download gff for RE40740.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7145880..7146883 194..1197 100 <- Minus
3R 7146945..7147092 46..193 100 <- Minus
3R 7147331..7147375 1..45 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:12:23 Download gff for RE40740.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2971602..2972605 194..1197 100 <- Minus
arm_3R 2972667..2972814 46..193 100 <- Minus
arm_3R 2973053..2973097 1..45 97   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:59:07 Download gff for RE40740.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6886711..6887714 194..1197 100 <- Minus
3R 6887776..6887923 46..193 100 <- Minus
3R 6888162..6888206 1..45 97   Minus

RE40740.hyp Sequence

Translation from 0 to 762

> RE40740.hyp
QYGLKAARTYNINFGPIYTMKLYAVSDGPPSLAVRMTLKALDIQYQLINV
DFCAMEHRSEEYSKMNPQKEIPVLDDDGFYLSESIAIMQYLCDKYAPDST
LYPQDVNVRAVINQRLCFNMGFYYAPISAHSMAPIFFDYKRTPMSLKKVQ
NALDVFETYLQRLGTKYAAGENITIADFALISATICLEAINFDLHQFTLV
NKWYETFKVEYPQLWEIANSGMQEISAFEQNPPDMSHMEHPFHPTRKSMG
LKL*

RE40740.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:13:01
Subject Length Description Subject Range Query Range Score Percent Strand
gfzf-PE 1045 CG33546-PE 808..1045 16..253 1259 100 Plus
gfzf-PB 1045 CG33546-PB 808..1045 16..253 1259 100 Plus
gfzf-PD 234 CG33546-PD 1..234 20..253 1236 100 Plus
GstD1-PB 209 CG10045-PB 5..207 23..228 329 36.4 Plus
GstD1-PA 209 CG10045-PA 5..207 23..228 329 36.4 Plus

RE40740.pep Sequence

Translation from 58 to 762

> RE40740.pep
MKLYAVSDGPPSLAVRMTLKALDIQYQLINVDFCAMEHRSEEYSKMNPQK
EIPVLDDDGFYLSESIAIMQYLCDKYAPDSTLYPQDVNVRAVINQRLCFN
MGFYYAPISAHSMAPIFFDYKRTPMSLKKVQNALDVFETYLQRLGTKYAA
GENITIADFALISATICLEAINFDLHQFTLVNKWYETFKVEYPQLWEIAN
SGMQEISAFEQNPPDMSHMEHPFHPTRKSMGLKL*

RE40740.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-17 01:16:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17320-PA 1018 GF17320-PA 788..1016 1..229 1128 88.2 Plus
Dana\GF17052-PA 209 GF17052-PA 4..207 3..209 341 38.3 Plus
Dana\GF17054-PA 210 GF17054-PA 1..210 1..212 323 34.7 Plus
Dana\GF12171-PA 222 GF12171-PA 4..188 1..184 315 37.4 Plus
Dana\GF12172-PA 222 GF12172-PA 4..210 1..208 314 37 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-17 01:16:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10036-PA 1042 GG10036-PA 812..1040 1..229 1191 93.9 Plus
Dere\GG21887-PA 222 GG21887-PA 4..211 1..208 328 37.3 Plus
Dere\GG17138-PA 210 GG17138-PA 1..210 1..212 324 36.2 Plus
Dere\GstD1-PA 209 GG17135-PA 4..207 3..209 323 34.8 Plus
Dere\GG17137-PA 218 GG17137-PA 12..197 11..197 321 39.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-17 01:16:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18587-PA 1041 GH18587-PA 811..1039 1..229 1078 83.4 Plus
Dgri\GH17521-PA 216 GH17521-PA 1..206 1..209 352 38.3 Plus
Dgri\GH20559-PA 216 GH20559-PA 1..206 1..209 350 37.8 Plus
Dgri\GH13103-PA 209 GH13103-PA 4..207 3..209 332 37.3 Plus
Dgri\GH20186-PA 209 GH20186-PA 4..207 3..209 332 37.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:13:34
Subject Length Description Subject Range Query Range Score Percent Strand
gfzf-PD 234 CG33546-PD 1..234 1..234 1236 100 Plus
gfzf-PE 1045 CG33546-PE 812..1045 1..234 1236 100 Plus
gfzf-PB 1045 CG33546-PB 812..1045 1..234 1236 100 Plus
GstD1-PB 209 CG10045-PB 5..207 4..209 329 36.4 Plus
GstD1-PA 209 CG10045-PA 5..207 4..209 329 36.4 Plus
GstD9-PB 218 CG10091-PB 2..197 1..197 323 38.2 Plus
GstD9-PA 218 CG10091-PA 2..197 1..197 323 38.2 Plus
GstD10-PB 210 CG18548-PB 1..210 1..212 322 37.2 Plus
GstD10-PA 210 CG18548-PA 1..210 1..212 322 37.2 Plus
GstE5-PA 222 CG17527-PA 4..209 1..206 322 38.1 Plus
GstE6-PA 222 CG17530-PA 4..211 1..208 320 37.3 Plus
GstE7-PA 223 CG17531-PA 6..212 3..209 315 34.3 Plus
GstD8-PA 212 CG4421-PA 1..208 1..211 309 36 Plus
GstD6-PA 215 CG4423-PA 1..184 1..186 297 34.9 Plus
GstD2-PA 215 CG4181-PA 1..205 1..208 286 34.4 Plus
GstD5-PA 216 CG12242-PA 1..203 1..206 284 33.3 Plus
GstD3-PA 199 CG4381-PA 1..178 17..197 280 34.3 Plus
GstE1-PA 224 CG5164-PA 8..213 3..209 280 34.9 Plus
GstD4-PA 215 CG11512-PA 1..187 1..189 277 34 Plus
GstE9-PA 221 CG17534-PA 6..207 3..204 277 33.2 Plus
GstE4-PA 222 CG17525-PA 4..205 1..202 275 32.5 Plus
GstD7-PA 224 CG4371-PA 4..213 1..212 275 33.9 Plus
GstE8-PB 222 CG17533-PB 6..209 3..206 271 32.9 Plus
GstE8-PA 222 CG17533-PA 6..209 3..206 271 32.9 Plus
GstD11-PA 222 CG17639-PA 6..190 3..189 261 31 Plus
GstD11-PB 243 CG17639-PB 27..211 3..189 261 31 Plus
GstE3-PA 220 CG17524-PA 4..211 1..209 253 31.8 Plus
GstE2-PA 221 CG17523-PA 7..190 3..186 247 32.3 Plus
GstE11-PB 225 CG5224-PB 7..190 3..184 238 35.5 Plus
GstE11-PA 225 CG5224-PA 7..190 3..184 238 35.5 Plus
GstE10-PB 240 CG17522-PB 6..189 3..184 227 31.2 Plus
GstE10-PA 240 CG17522-PA 6..189 3..184 227 31.2 Plus
GstE13-PB 226 CG11784-PB 6..210 3..206 216 29.5 Plus
GstE13-PA 226 CG11784-PA 6..210 3..206 216 29.5 Plus
GstE12-PC 223 CG16936-PC 6..211 3..208 215 30.3 Plus
GstE12-PB 223 CG16936-PB 6..211 3..208 215 30.3 Plus
GstE12-PD 223 CG16936-PD 6..211 3..208 215 30.3 Plus
GstE12-PA 223 CG16936-PA 6..211 3..208 215 30.3 Plus
GstE14-PA 232 CG4688-PA 8..201 3..212 180 25 Plus
GstZ2-PC 215 CG9363-PC 6..184 3..181 147 25.5 Plus
GstZ2-PB 220 CG9363-PB 11..189 3..181 147 25.5 Plus
GstZ2-PA 227 CG9363-PA 18..196 3..181 147 25.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-17 01:16:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24516-PA 1070 GI24516-PA 840..1067 1..228 1055 82.5 Plus
Dmoj\GI24379-PA 209 GI24379-PA 4..207 3..209 317 34.3 Plus
Dmoj\GI22354-PA 208 GI22354-PA 1..206 1..209 316 34.9 Plus
Dmoj\GI22356-PA 210 GI22356-PA 1..209 1..211 308 34.9 Plus
Dmoj\GI23193-PA 214 GI23193-PA 1..202 1..205 307 33.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-17 01:16:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12196-PA 1039 GL12196-PA 808..1037 1..229 1083 85.2 Plus
Dper\GL27184-PA 209 GL27184-PA 4..207 3..209 343 37.2 Plus
Dper\GL17773-PA 222 GL17773-PA 4..211 1..208 330 36 Plus
Dper\GL27301-PA 213 GL27301-PA 1..202 1..204 327 36.4 Plus
Dper\GL27186-PA 209 GL27186-PA 1..209 1..212 318 37.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-17 01:16:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26222-PA 1039 GA26222-PA 808..1037 1..229 1084 85.2 Plus
Dpse\GA26222-PB 232 GA26222-PB 1..230 1..229 1075 85.2 Plus
Dpse\GA10031-PA 209 GA10031-PA 4..207 3..209 343 37.2 Plus
Dpse\GA27027-PA 213 GA27027-PA 1..202 1..204 325 35.1 Plus
Dpse\GA14545-PA 222 GA14545-PA 4..211 1..208 325 36 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-17 01:16:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10504-PA 265 GM10504-PA 33..265 1..233 1201 94.4 Plus
Dsec\GstD1-PA 209 GM26019-PA 4..207 3..209 343 37.2 Plus
Dsec\GM26022-PA 210 GM26022-PA 1..210 1..212 343 38.6 Plus
Dsec\GM21880-PA 222 GM21880-PA 4..209 1..206 323 37.1 Plus
Dsec\GM26021-PA 218 GM26021-PA 12..197 11..197 321 40.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-17 01:16:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19500-PA 1038 GD19500-PA 806..1038 1..233 1225 95.7 Plus
Dsim\GstD1-PA 209 GD20577-PA 4..207 3..209 340 36.7 Plus
Dsim\GD20579-PA 210 GD20579-PA 1..210 1..212 340 38.1 Plus
Dsim\GD18819-PA 215 GD18819-PA 1..184 1..186 325 36.6 Plus
Dsim\GD11374-PA 222 GD11374-PA 4..209 1..206 324 37.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-17 01:16:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22689-PA 1053 GJ22689-PA 823..1051 1..229 1077 83.4 Plus
Dvir\GJ24385-PA 209 GJ24385-PA 4..207 3..209 348 37.2 Plus
Dvir\GJ14446-PA 213 GJ14446-PA 1..209 1..212 323 34 Plus
Dvir\GJ24386-PA 214 GJ24386-PA 12..197 11..197 320 38.1 Plus
Dvir\GJ22855-PA 200 GJ22855-PA 1..169 17..187 303 38.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-17 01:16:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12738-PA 1061 GK12738-PA 830..1057 1..228 1101 86 Plus
Dwil\GK11204-PA 209 GK11204-PA 4..207 3..209 351 38.2 Plus
Dwil\GK11206-PA 210 GK11206-PA 1..210 1..212 331 38 Plus
Dwil\GK11205-PA 217 GK11205-PA 12..197 11..197 326 39.7 Plus
Dwil\GK11878-PA 212 GK11878-PA 1..205 1..209 320 36.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-17 01:16:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25813-PA 1042 GE25813-PA 812..1040 1..229 1188 93.4 Plus
Dyak\GE24529-PA 210 GE24529-PA 1..210 1..212 338 37.7 Plus
Dyak\GstD1-PA 209 GE24527-PA 4..207 3..209 336 36.7 Plus
Dyak\GE11963-PA 222 GE11963-PA 4..211 1..208 327 38.1 Plus
Dyak\GE26179-PA 215 GE26179-PA 1..184 1..186 320 35.5 Plus