Clone RE40776 Report

Search the DGRC for RE40776

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:407
Well:76
Vector:pFlc-1
Associated Gene/TranscriptCG8116-RA
Protein status:RE40776.pep: gold
Preliminary Size:950
Sequenced Size:1850

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8116 2002-01-01 Sim4 clustering to Release 2
CG8116 2002-02-27 Blastp of sequenced clone
CG8116 2008-04-29 Release 5.5 accounting
CG8116 2008-08-15 Release 5.9 accounting
CG11760 2008-08-15 Release 5.9 accounting
CG8116 2008-12-18 5.12 accounting
CG11760 2008-12-18 5.12 accounting

Clone Sequence Records

RE40776.complete Sequence

1850 bp (1850 high quality bases) assembled on 2002-02-27

GenBank Submission: AY084168

> RE40776.complete
AATTTCTCCGTTACTCGCCCATGGCCACATTTGTGCATGTGCGTTTGAGG
TTCCTTTCCTTTTTATATAAGCCCCTCGTCTCTTGCCAACAAACCAACAA
CAACAACAACCAGCCAGGCCAGCGGGCAACAACAACGCACAACAACGCGT
ATAAATAAACGTGAACGCATGTACTTAATATTAGCATAGAGTTGTCGCCT
GCGTGCATTTCATATACATAACATAACATCCACTTACTCCCATGACAACG
GGACTTTAGACAGTAACGGTGGAGCAGCTAGAAGAAGAGGAAAGGCGAAG
TAGAACGGGAACAAGAAGAAAAAGCAGTGGAAGAGCAGGTATCACCACCA
CGTACCGCCCAAAGGTCCCAATGCTGGCGTAGAGAAGCCGAAACACCTGC
TGCTGCCAGTGGAAAAGCGGGAGGAGCTGCTCCAAACTGCCCAGGTGACA
TCCAATCATTTAGAGGCGACGCACCTGCCGCCTTGAGGAACTGGTCGCCA
CGCAGGAGGACACGGATACGGCAACGGTTACGGACTCGTTTCCGCAGTAG
CGGGCACCATGAACGCCAGCCTCATCTATGAGATACTTATGTATCTGAAC
TCGTTCTACTTTGGCATGTACGCCGCCTTCGAAGTGGGCGTGGGCGTTCT
TAAGGCGATTAATCTAAACTACGGCGAGAACGCGTTGTCCCGGGAGGCCA
GCATCCTGCTCTCACTGTGCATCATCGAGACCGTGCGCATTGTCTTCGGG
CGGAAGAGCAGTCTAAGCGATCGTGGCTGGCAAGCAACCGCATCCGTAAT
ATTAACACTGCCCAGTCTTGCTATTGTTATCTACTTGTGTTGTTTTCAAA
CCTTTGTTCTCAAACTCGAAATTATTCTGAGTGCCTTAATGATCACCCTA
CAAGGTGCTGAACTAGTCTACGCCAGCATATTCATTTGTACAATGTGTCG
CCCCGTCACATACACCTAGCAGTTGATAAGCCGCGTTGCCGCCGCCACGT
CAACGACCAAGATCGAGATCAAGACCAAGCCAGCACTAACACTCCCACCT
GGAGGAGAAGGAGTAGAAGCATCCACAGCCGAGCGACGACTACGACGAAG
ACGAAACACTTTCCTCTGGCAATTTCACATCAAACGATTCGCCAAGGCCT
CAAAACTAAGCCACTTAAATGCACACTAAGCCACCGCACATAAAAACAAA
ACAAAAAATCTAGATCCTACTAGACCTCCTAGGAATCCGTGCCAAGACAA
CCCGATAACATACCCAATGGCTGGCAGTTGAGGAGGACTTTCAACAAGGC
TGGTCGGCCATACTGTCGGTCTTCATGACCGCCCCCTGCTTTGTGGGCGT
CTCCTATCTACTGCTGCTCCAGACCTACCGACTGCGCCTGGAGTACTGCC
TGTGCACGCTGCAGATCGCCCTTTACCTGACCGAGGTGTGGTATGCCATC
GTCTTCGTTTTCTCGCTGTGTCGTCCAGTAACTTATGATTAGCCATATAG
ACAGAAACATCCAACAGCCAACTAGCAGCAAATATACATGCGAAAGTTTA
GCAATCTATAAGATCGAAAAAGGATAATATGCGGTGTAAGGAAATTTAAT
GAATTTGAAAAGCAGTAGGCAGCTGAATTGCTCATGGCCGTGGAGAAGAG
AAACCAAACAGAAAGAAAAAAAAAACAAAACAAAACACATATGTAGCATA
TTAATAATTATGTATAGTAAGGTTTATGATAACATACACACACTCTTATA
TACATATATTTAACGGTTTTATATACAAAAATTGTTAACATTTAAGCATC
AATTGGAACCAATATAAGACAACAAGCAAAACCTAAAAAAAAAAAAAAAA

RE40776.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:23:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG8116-RC 1835 CG8116-RC 1..1835 1..1834 9135 99.9 Plus
CG8116-RB 2829 CG8116-RB 339..1844 334..1838 7490 99.9 Plus
CG8116-RA 1840 CG8116-RA 339..1840 334..1834 7470 99.9 Plus
CG8116-RB 2829 CG8116-RB 1..335 1..335 1675 100 Plus
CG8116-RA 1840 CG8116-RA 1..335 1..335 1675 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:39:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4543818..4544342 775..1299 2625 100 Plus
chr3R 27901430 chr3R 4545774..4546312 1297..1834 2600 99.3 Plus
chr3R 27901430 chr3R 4542882..4543312 346..776 2155 100 Plus
chr3R 27901430 chr3R 4542204..4542538 1..335 1675 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:55:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:39:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8719802..8720343 1297..1838 2710 100 Plus
3R 32079331 3R 8717848..8718372 775..1299 2625 100 Plus
3R 32079331 3R 8716899..8717342 334..776 2170 99.8 Plus
3R 32079331 3R 8716234..8716568 1..335 1675 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:52:19
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 8460633..8461174 1297..1838 2710 100 Plus
3R 31820162 3R 8458679..8459203 775..1299 2625 100 Plus
3R 31820162 3R 8457730..8458173 334..776 2180 99.7 Plus
3R 31820162 3R 8457065..8457399 1..335 1675 100 Plus
Blast to na_te.dros performed 2019-03-16 13:39:41
Subject Length Description Subject Range Query Range Score Percent Strand
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 2107..2181 66..141 125 64.5 Plus
TART-C 11124 TART-C TARTC 11124bp 1351..1425 66..141 125 64.5 Plus

RE40776.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:40:27 Download gff for RE40776.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4542204..4542482 1..279 100 == Plus
chr3R 4542882..4543311 346..775 100 -> Plus
chr3R 4543819..4544341 776..1298 100 -> Plus
chr3R 4545776..4546312 1299..1834 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:15:33 Download gff for RE40776.complete
Subject Subject Range Query Range Percent Splice Strand
CG8116-RA 1..411 559..969 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:32:38 Download gff for RE40776.complete
Subject Subject Range Query Range Percent Splice Strand
CG8116-RC 1..411 559..969 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:25:16 Download gff for RE40776.complete
Subject Subject Range Query Range Percent Splice Strand
CG8116-RA 1..411 559..969 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:05:27 Download gff for RE40776.complete
Subject Subject Range Query Range Percent Splice Strand
CG8116-RA 1..411 559..969 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:17:17 Download gff for RE40776.complete
Subject Subject Range Query Range Percent Splice Strand
CG8116-RA 1..411 559..969 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:58:35 Download gff for RE40776.complete
Subject Subject Range Query Range Percent Splice Strand
CG11760-RA 1..686 1149..1834 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:32:38 Download gff for RE40776.complete
Subject Subject Range Query Range Percent Splice Strand
CG8116-RC 1..1835 1..1834 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:25:16 Download gff for RE40776.complete
Subject Subject Range Query Range Percent Splice Strand
CG8116-RC 1..1826 10..1834 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:05:27 Download gff for RE40776.complete
Subject Subject Range Query Range Percent Splice Strand
CG11760-RA 1..686 1149..1834 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:17:17 Download gff for RE40776.complete
Subject Subject Range Query Range Percent Splice Strand
CG8116-RC 1..1826 10..1834 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:40:27 Download gff for RE40776.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8716234..8716568 1..335 100 -> Plus
3R 8716901..8717341 336..775 99 -> Plus
3R 8717849..8718371 776..1298 100 -> Plus
3R 8719804..8720339 1299..1834 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:40:27 Download gff for RE40776.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8716234..8716568 1..335 100 -> Plus
3R 8716901..8717341 336..775 99 -> Plus
3R 8717849..8718371 776..1298 100 -> Plus
3R 8719804..8720339 1299..1834 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:40:27 Download gff for RE40776.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8716234..8716568 1..335 100 -> Plus
3R 8716901..8717341 336..775 99 -> Plus
3R 8717849..8718371 776..1298 100 -> Plus
3R 8719804..8720339 1299..1834 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:25:16 Download gff for RE40776.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4541956..4542290 1..335 100 -> Plus
arm_3R 4542623..4543063 336..775 99 -> Plus
arm_3R 4543571..4544093 776..1298 100 -> Plus
arm_3R 4545526..4546061 1299..1834 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:39:15 Download gff for RE40776.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8457065..8457399 1..335 100 -> Plus
3R 8457732..8458172 336..775 99 -> Plus
3R 8458680..8459202 776..1298 100 -> Plus
3R 8460635..8461170 1299..1834 100   Plus

RE40776.hyp Sequence

Translation from 558 to 968

> RE40776.hyp
MNASLIYEILMYLNSFYFGMYAAFEVGVGVLKAINLNYGENALSREASIL
LSLCIIETVRIVFGRKSSLSDRGWQATASVILTLPSLAIVIYLCCFQTFV
LKLEIILSALMITLQGAELVYASIFICTMCRPVTYT*

RE40776.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:18:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG8116-PC 136 CG8116-PC 1..136 1..136 677 100 Plus
CG8116-PB 136 CG8116-PB 1..136 1..136 677 100 Plus
CG8116-PA 136 CG8116-PA 1..136 1..136 677 100 Plus
CG11760-PB 149 CG11760-PB 15..148 2..135 346 48.5 Plus

RE40776.pep Sequence

Translation from 558 to 968

> RE40776.pep
MNASLIYEILMYLNSFYFGMYAAFEVGVGVLKAINLNYGENALSREASIL
LSLCIIETVRIVFGRKSSLSDRGWQATASVILTLPSLAIVIYLCCFQTFV
LKLEIILSALMITLQGAELVYASIFICTMCRPVTYT*

RE40776.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:38:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18182-PA 136 GF18182-PA 1..136 1..136 666 94.9 Plus
Dana\GF18183-PA 149 GF18183-PA 17..148 4..135 301 46.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:38:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12263-PA 136 GG12263-PA 1..136 1..136 693 100 Plus
Dere\GG12372-PA 149 GG12372-PA 17..148 4..135 323 47.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:38:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18572-PA 136 GH18572-PA 1..136 1..136 678 97.1 Plus
Dgri\GH18573-PA 149 GH18573-PA 17..148 4..135 324 47 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:18:34
Subject Length Description Subject Range Query Range Score Percent Strand
TMEM216-PC 136 CG8116-PC 1..136 1..136 677 100 Plus
TMEM216-PB 136 CG8116-PB 1..136 1..136 677 100 Plus
TMEM216-PA 136 CG8116-PA 1..136 1..136 677 100 Plus
CG11760-PB 149 CG11760-PB 15..148 2..135 346 48.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:38:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22390-PA 136 GI22390-PA 1..136 1..136 678 97.1 Plus
Dmoj\GI22391-PA 149 GI22391-PA 17..148 4..135 328 47.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:38:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12472-PA 136 GL12472-PA 1..136 1..136 678 97.1 Plus
Dper\GL12473-PA 149 GL12473-PA 15..148 2..135 339 48.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:38:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20835-PA 136 GA20835-PA 1..136 1..136 678 97.1 Plus
Dpse\GA27519-PA 149 GA27519-PA 15..148 2..135 339 48.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:38:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23754-PA 136 GM23754-PA 1..136 1..136 688 99.3 Plus
Dsec\GM23755-PA 149 GM23755-PA 17..148 4..135 326 48.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:38:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18565-PA 136 GD18565-PA 1..136 1..136 688 99.3 Plus
Dsim\GD18566-PA 149 GD18566-PA 17..148 4..135 326 48.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:38:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22675-PA 136 GJ22675-PA 1..136 1..136 678 97.1 Plus
Dvir\GJ22676-PA 149 GJ22676-PA 17..148 4..135 331 48.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:38:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11810-PA 136 GK11810-PA 1..136 1..136 680 97.1 Plus
Dwil\GK11811-PA 149 GK11811-PA 17..148 4..135 328 48.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:38:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25897-PA 136 GE25897-PA 1..136 1..136 693 100 Plus
Dyak\GE25898-PA 149 GE25898-PA 17..148 4..135 326 48.5 Plus