Clone RE40783 Report

Search the DGRC for RE40783

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:407
Well:83
Vector:pFlc-1
Associated Gene/TranscriptCG4962-RA
Protein status:RE40783.pep: gold
Preliminary Size:613
Sequenced Size:783

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4962 2002-01-01 Sim4 clustering to Release 2
CG4962 2002-02-27 Blastp of sequenced clone
CG4962 2003-01-01 Sim4 clustering to Release 3
CG4962 2008-04-29 Release 5.5 accounting
CG4962 2008-08-15 Release 5.9 accounting
CG4962 2008-12-18 5.12 accounting

Clone Sequence Records

RE40783.complete Sequence

783 bp (783 high quality bases) assembled on 2002-02-27

GenBank Submission: AY084169

> RE40783.complete
AAGCATAACACATTCAGCTCTTCGGTCAAGAAGTCCAAACAACACAAAAC
CAGCAAAATGTTCAAACTGATTGCCCTCATCTCTGCCCTGTGCGCCGTGG
CCAATGCCGGAGTAATCTCGCCCTACAGCCATGGATATGGACTGGGATAC
GGCGCCGCCTTGGCTCCGGCTTATGCCGCTCCGGCTGTGATCTCGCACGC
CCCGATCATCAAGAGCTACGCCGCTCCCATTGTCGCCCACCCGGTGGCCA
CCTCCTATGCCAACACCTACAAGGTGGCCACCAAGGCCATTCCAGTGGTC
CATGCCGCTCCTCTGGTCCATGCCGTGCCTGCTCTGCACTCCACCTCCAC
CTACCATGGATCCTATGGCGGCTACGGTAGCTACGGTCTGGGATACGCCG
GCTACGGACACGGAGCCTACCTGCACTAAGGATCTGGATGTCGGAAAGGA
TACCAGCCCCCCGTTGACGACCCCGATTGAAGTGAGAACATTAAGCGGAT
AATTCGCATTTTGCTGCCGTCAAAGTGTTGAATTTGCATTTCGTAGTCAG
AAGCGGAAATACAAATTGTGTACAAAATCCCTCAAAAACCCAGACACCCA
CTTGGAGACAGAGACAACTAGAGAACTAAGGACAACTAACGGGAGGCGGC
GAGAGCGAGAGAGATTGATGAAGGATCAAGTTTCGTTGATTTTGTTATTA
TGGTGCAACTCCATGCATTGTGGCTTCATAACATTTTGTAAATAAACGAT
AAATGACTCTTTAAACGAAAAAAAAAAAAAAAA

RE40783.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:56:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG4962-RA 886 CG4962-RA 115..883 1..769 3845 100 Plus
CG4962.b 810 CG4962.b 107..587 1..481 2405 100 Plus
CG4962.a 763 CG4962.a 107..587 1..481 2405 100 Plus
CG4962.b 810 CG4962.b 588..810 547..769 1115 100 Plus
CG4962.a 763 CG4962.a 588..763 594..769 880 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:17:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16284432..16285130 767..69 3390 99 Minus
chr3L 24539361 chr3L 16285193..16285261 69..1 345 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:55:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:17:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16294709..16295409 769..69 3505 100 Minus
3L 28110227 3L 16295472..16295540 69..1 345 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:15:18
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16287809..16288509 769..69 3505 100 Minus
3L 28103327 3L 16288572..16288640 69..1 345 100 Minus
Blast to na_te.dros performed 2019-03-15 20:17:41
Subject Length Description Subject Range Query Range Score Percent Strand
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 5581..5623 324..285 109 76.7 Minus

RE40783.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:18:27 Download gff for RE40783.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16284432..16285129 70..767 98 <- Minus
chr3L 16285193..16285261 1..69 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:15:34 Download gff for RE40783.complete
Subject Subject Range Query Range Percent Splice Strand
CG4962-RA 1..372 58..429 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:54:11 Download gff for RE40783.complete
Subject Subject Range Query Range Percent Splice Strand
CG4962-RA 1..372 58..429 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:10:38 Download gff for RE40783.complete
Subject Subject Range Query Range Percent Splice Strand
CG4962-RA 1..372 58..429 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:36:42 Download gff for RE40783.complete
Subject Subject Range Query Range Percent Splice Strand
CG4962-RA 1..372 58..429 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:19:33 Download gff for RE40783.complete
Subject Subject Range Query Range Percent Splice Strand
CG4962-RA 1..372 58..429 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:06:53 Download gff for RE40783.complete
Subject Subject Range Query Range Percent Splice Strand
CG4962-RA 1..767 1..767 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:54:11 Download gff for RE40783.complete
Subject Subject Range Query Range Percent Splice Strand
CG4962-RA 1..767 1..767 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:10:38 Download gff for RE40783.complete
Subject Subject Range Query Range Percent Splice Strand
CG4962-RA 8..774 1..767 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:36:43 Download gff for RE40783.complete
Subject Subject Range Query Range Percent Splice Strand
CG4962-RA 1..767 1..767 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:19:33 Download gff for RE40783.complete
Subject Subject Range Query Range Percent Splice Strand
CG4962-RA 8..774 1..767 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:18:27 Download gff for RE40783.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16295472..16295540 1..69 100   Minus
3L 16294711..16295408 70..767 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:18:27 Download gff for RE40783.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16295472..16295540 1..69 100   Minus
3L 16294711..16295408 70..767 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:18:27 Download gff for RE40783.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16295472..16295540 1..69 100   Minus
3L 16294711..16295408 70..767 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:10:38 Download gff for RE40783.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16287811..16288508 70..767 100 <- Minus
arm_3L 16288572..16288640 1..69 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:19:23 Download gff for RE40783.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16287811..16288508 70..767 100 <- Minus
3L 16288572..16288640 1..69 100   Minus

RE40783.hyp Sequence

Translation from 0 to 428

> RE40783.hyp
KHNTFSSSVKKSKQHKTSKMFKLIALISALCAVANAGVISPYSHGYGLGY
GAALAPAYAAPAVISHAPIIKSYAAPIVAHPVATSYANTYKVATKAIPVV
HAAPLVHAVPALHSTSTYHGSYGGYGSYGLGYAGYGHGAYLH*

RE40783.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:07:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG4962-PA 123 CG4962-PA 1..123 20..142 646 100 Plus
CG13041-PA 124 CG13041-PA 1..106 20..121 153 34.9 Plus
CG13060-PA 131 CG13060-PA 1..99 20..114 144 36.4 Plus

RE40783.pep Sequence

Translation from 57 to 428

> RE40783.pep
MFKLIALISALCAVANAGVISPYSHGYGLGYGAALAPAYAAPAVISHAPI
IKSYAAPIVAHPVATSYANTYKVATKAIPVVHAAPLVHAVPALHSTSTYH
GSYGGYGSYGLGYAGYGHGAYLH*

RE40783.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:03:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10300-PA 129 GF10300-PA 1..129 1..123 521 91.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:03:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13472-PA 129 GG13472-PA 1..129 1..123 546 92.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:03:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15611-PA 149 GH15611-PA 1..117 1..98 244 64.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG4962-PA 123 CG4962-PA 1..123 1..123 646 100 Plus
CG13041-PA 124 CG13041-PA 1..106 1..102 153 34.9 Plus
CG13060-PA 131 CG13060-PA 1..99 1..95 144 36.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:03:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16887-PA 131 GI16887-PA 1..110 1..98 285 76.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:03:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18013-PA 138 GL18013-PA 1..112 1..100 345 80.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:03:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18556-PA 138 GA18556-PA 1..112 1..100 345 80.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:03:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24421-PA 129 GM24421-PA 1..129 1..123 557 95.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:03:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12491-PA 129 GD12491-PA 1..129 1..123 557 95.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:03:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12636-PA 138 GJ12636-PA 1..109 1..98 348 79.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:03:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17645-PA 133 GK17645-PA 1..107 1..98 315 84.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:03:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22569-PA 129 GE22569-PA 1..129 1..123 554 93.8 Plus
Dyak\GE23105-PA 129 GE23105-PA 1..129 1..123 551 93 Plus