Clone RE40816 Report

Search the DGRC for RE40816

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:408
Well:16
Vector:pFlc-1
Associated Gene/TranscriptCG31337-RA
Protein status:RE40816.pep: gold
Sequenced Size:846

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12538 2002-01-01 Sim4 clustering to Release 2
CG31337 2002-02-27 Blastp of sequenced clone
CG31337 2003-01-01 Sim4 clustering to Release 3
CG31337 2008-04-29 Release 5.5 accounting
CG31337 2008-08-15 Release 5.9 accounting
CG31337 2008-12-18 5.12 accounting

Clone Sequence Records

RE40816.complete Sequence

846 bp (846 high quality bases) assembled on 2002-02-27

GenBank Submission: AY084170

> RE40816.complete
AGTTTGGGTTCCGCTATCCACACGCGGAGTGAGTTTTCGGCGCTTAAAGT
GCTTAAGACCTTAAAGCGAGTTTAATGCGTGGCATATACCACGGCATATA
CATACCATCGTCATCTTTGCGGGGAAAAGTCTGCGGCATAACAACTGCTT
CCGAAATTGTAAATTCACAATGCGGCGCGCATCTCGATTGATTCCGTTCG
GTTTCGTCATCCTGCTCCTGATTCTTCTGCTCCTCCAGCCATCGACAGAC
GGCCACACACTGGGCGCCAGCTGCCAGACGCCCGAGAAGAGCGAAGGACG
CTGTGTGCACTTCAGCTCCTGCCGGCTCGTCTTGCGTCACTATGCGATGT
ACAAGGAGCACATGCCGCCAGCGATAATGCGATTCCTGCAGAGGGTCCGT
TGCAAGCCGAAACGCGAAGGCTATCATTTGTGCTGCGAACTCAAAGATGT
GATTCCCGCGAACGCCAACTCCAAGTTGAAGTAAATCAACTTCAAAGTGC
CTCATGTGCGTGCGAGCGAGTGTGCGGACTTTGATCTGCTAAATCAGTTG
GTAGCTTTTTGTTTGGGCCCATAACCGAAATGTTATGGCCGCGTGCGGCA
TCGCCTTTAATTATAATGTGTACACGAATTATGTATTAAGTGCGCCTTTC
GCCAGTCTCGCCAAGGCAACAGATGCTGGGACATAATAAAAAATAAAAAG
TTTAGCCTCAATCTTGACAGCTCCTGCTCGAGTTGGTTCTTGTGTATTTA
AAAGCATAAATAAATTTGAACTTGCAACACCTACTGCCTGGCGTCTGTCA
GTAGTCGGGCATCGAAATAAATATTTGAAATACAAAAAAAAAAAAA

RE40816.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:23:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG31337-RA 875 CG31337-RA 34..867 1..834 4155 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:53:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9369014..9369425 833..422 2060 100 Minus
chr3R 27901430 chr3R 9370173..9370432 260..1 1285 99.6 Minus
chr3R 27901430 chr3R 9369594..9369754 421..261 790 99.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:55:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:53:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13543965..13544377 834..422 2065 100 Minus
3R 32079331 3R 13545125..13545384 260..1 1285 99.6 Minus
3R 32079331 3R 13544546..13544706 421..261 805 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:52:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13284796..13285208 834..422 2065 100 Minus
3R 31820162 3R 13285956..13286215 260..1 1285 99.6 Minus
3R 31820162 3R 13285377..13285537 421..261 805 100 Minus
Blast to na_te.dros performed on 2019-03-16 05:53:12 has no hits.

RE40816.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:53:55 Download gff for RE40816.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9369014..9369425 422..833 100 <- Minus
chr3R 9369594..9369754 261..421 99 <- Minus
chr3R 9370173..9370432 1..260 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:15:35 Download gff for RE40816.complete
Subject Subject Range Query Range Percent Splice Strand
CG31337-RA 1..315 170..484 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:32:40 Download gff for RE40816.complete
Subject Subject Range Query Range Percent Splice Strand
CG31337-RA 1..315 170..484 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:29:36 Download gff for RE40816.complete
Subject Subject Range Query Range Percent Splice Strand
CG31337-RA 1..315 170..484 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:05:28 Download gff for RE40816.complete
Subject Subject Range Query Range Percent Splice Strand
CG31337-RA 1..315 170..484 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:09:23 Download gff for RE40816.complete
Subject Subject Range Query Range Percent Splice Strand
CG31337-RA 1..315 170..484 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:58:37 Download gff for RE40816.complete
Subject Subject Range Query Range Percent Splice Strand
CG31337-RA 1..827 1..827 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:32:40 Download gff for RE40816.complete
Subject Subject Range Query Range Percent Splice Strand
CG31337-RA 1..833 1..833 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:29:36 Download gff for RE40816.complete
Subject Subject Range Query Range Percent Splice Strand
CG31337-RA 1..833 1..833 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:05:29 Download gff for RE40816.complete
Subject Subject Range Query Range Percent Splice Strand
CG31337-RA 1..827 1..827 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:09:23 Download gff for RE40816.complete
Subject Subject Range Query Range Percent Splice Strand
CG31337-RA 17..849 1..833 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:53:55 Download gff for RE40816.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13543966..13544377 422..833 100 <- Minus
3R 13544546..13544706 261..421 100 <- Minus
3R 13545125..13545384 1..260 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:53:55 Download gff for RE40816.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13543966..13544377 422..833 100 <- Minus
3R 13544546..13544706 261..421 100 <- Minus
3R 13545125..13545384 1..260 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:53:55 Download gff for RE40816.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13543966..13544377 422..833 100 <- Minus
3R 13544546..13544706 261..421 100 <- Minus
3R 13545125..13545384 1..260 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:29:36 Download gff for RE40816.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9370847..9371106 1..260 99   Minus
arm_3R 9369688..9370099 422..833 100 <- Minus
arm_3R 9370268..9370428 261..421 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:39:16 Download gff for RE40816.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13285956..13286215 1..260 99   Minus
3R 13284797..13285208 422..833 100 <- Minus
3R 13285377..13285537 261..421 100 <- Minus

RE40816.hyp Sequence

Translation from 169 to 483

> RE40816.hyp
MRRASRLIPFGFVILLLILLLLQPSTDGHTLGASCQTPEKSEGRCVHFSS
CRLVLRHYAMYKEHMPPAIMRFLQRVRCKPKREGYHLCCELKDVIPANAN
SKLK*

RE40816.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:26:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG31337-PA 104 CG31337-PA 1..104 1..104 554 100 Plus

RE40816.pep Sequence

Translation from 169 to 483

> RE40816.pep
MRRASRLIPFGFVILLLILLLLQPSTDGHTLGASCQTPEKSEGRCVHFSS
CRLVLRHYAMYKEHMPPAIMRFLQRVRCKPKREGYHLCCELKDVIPANAN
SKLK*

RE40816.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:45:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17376-PA 107 GF17376-PA 1..107 1..104 405 78.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:45:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17043-PA 104 GG17043-PA 1..104 1..104 462 92.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:45:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19063-PA 79 GH19063-PA 9..79 34..104 311 78.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:51:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG31337-PA 104 CG31337-PA 1..104 1..104 554 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:45:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10699-PA 106 GI10699-PA 1..106 1..104 327 67 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:45:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23979-PA 99 GL23979-PA 19..99 25..104 327 79.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:45:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16190-PA 102 GA16190-PA 22..102 25..104 327 79.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:45:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25927-PA 104 GM25927-PA 1..104 1..104 533 98.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:45:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20491-PA 104 GD20491-PA 1..104 1..104 540 99 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:45:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23116-PA 109 GJ23116-PA 39..109 34..104 330 83.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:45:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13340-PA 91 GK13340-PA 1..45 60..104 218 86.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:45:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24434-PA 105 GE24434-PA 1..105 1..104 464 92.4 Plus