Clone RE40914 Report

Search the DGRC for RE40914

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:409
Well:14
Vector:pFlc-1
Associated Gene/TranscriptCG7071-RA
Protein status:RE40914.pep: gold
Preliminary Size:625
Sequenced Size:1505

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7071 2002-01-01 Sim4 clustering to Release 2
CG7071 2002-02-26 Blastp of sequenced clone
CG7071 2003-01-01 Sim4 clustering to Release 3
CG7071 2008-04-29 Release 5.5 accounting
CG34131 2008-08-15 Release 5.9 accounting
CG7071 2008-08-15 Release 5.9 accounting
CG34131 2008-12-18 5.12 accounting
CG7071 2008-12-18 5.12 accounting

Clone Sequence Records

RE40914.complete Sequence

1505 bp (1505 high quality bases) assembled on 2002-02-26

GenBank Submission: AY084172

> RE40914.complete
ATGGGACAGCTGTGGGCGAATGAAAATAATGATAAGCCAAGTCGGACGAG
AGCTCTACAAGGTGCCGCTTCGCATTCTAGACCATCGCGTGTTCGTAAAC
GGCGAGATCGAGGCCTTTCTTGAGAACTTCGAGGTGCGGCGCAACGACAG
CGAAGTGGAGAAACTTTTCCAGGTCACAGAAACAGTGGGATCTCTGAAGT
ACGATCTGTCCCGGTGCAGTGCAACCGGAAGGGGTAGCGGAGCCGAGAAC
CTCGCCCAACTGGACACGGAAGTCAGCCATCTGCTGGACGGGGTCAACGC
ACTCTTGGCGAAAGCGAAGGTGGAACGAACTGCTAGCACCCAGTTGCAGG
AGGCGCGACTGGCACGTGAGCAACGCCGGGCGGAGGTCCTAACCAATTTG
GAGCACGGCTATCGCCGAATCGAGAACTCATTCGAGGAGAAGGAGGAGGA
AATCGCAGAGCTTTACTCAGATTTGCAACTAAAGCTTAACATTGCCAAGT
AGAAACTATGCTGAAGTCAACGATTGTTGATCCGCGGGTGCGCCTTGTGC
CGTCAAAGAAGCTGCTTGACTTTCTGGACGCCCAAAAGAAGCACTTAAAG
GAGTTGCCCGAAAATGTGGCCAAGATTATGAAGCAAAGAGGCCACACACT
GCCCACCTCTATTAGGATTATCAAGGATGCGGGCTTGGAGTACAAACGAC
CAAAACTCAATTACGAGCTGTTGACAAAACTAACTGAAAACCTAGCCGAC
AAACCAGAAGAACCTGCTAAGGATAAATCGGAACCAGATTCAGGGGTCAA
GGATAGTGATGACGCAAAGTCAACAAGGGAGGTTAAACATTTCCTATACT
TAACCGACCTGCACTGGCTCTCAAAAACACTGGCTGAACTGCGTCGTCAG
GATCACTGCCAAGTCTTTCTGCATCAGCTAATTGAGTCCTGTGATCTGCT
CCTGCCCGAAAACGAAATGAAGCCGCGCAATCCTGAGCTAGAAGCGCGCT
GCCAACGTCTTCGCGCAGAGCAACAAAATCGGGATTACCTCAAAATGACC
AAGAATGTGGATGCCGGCTTAAAACACTATCCAGAGGACACTATCAGCTA
TCAGATTAAGAGCCTTAACAAGCAAATCATTGCCGTGGTGCAGTTCATCT
TCTCCGTGGCCGCTGGCTTTACGTTCGGCTTTTTCGGCGTCAATTTGATG
GTGGGCCCGCTGCCTTTCGGCTTTCGCATCTTGCTGGGCGTGATTGTAGC
GCTCATCATAGCCCTGGCTGAGATGTACTTCCTGGCCAAGAAGCTGCACG
AGTACGATGAGGTCTTGGACGCGCCCAAACGTAAGCCGCAGCCATCGACG
CCGGCTAAGCGCACCCCGCCCGCCGAGGGAAGTCAAGTCCAGACATTGAA
ACCCCATGTTGACTAGATAGATGATCTGCGAGTAAAAATCGTTCTTTGTC
GTTGTATTATTTCGCTTTGCAATGTTAGGTTATATAAATAAAAAAAAAAA
AAAAA

RE40914.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:23:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG34131-RA 1489 CG34131-RA 1..1489 1..1489 7400 99.7 Plus
CG7071-RA 1489 CG7071-RA 1..1489 1..1489 7400 99.7 Plus
CG7071-RB 1476 CG7071-RB 32..1473 49..1490 7180 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:00:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 18186898..18187676 332..1110 3790 99.1 Plus
chr3R 27901430 chr3R 18187735..18188118 1106..1489 1905 99.7 Plus
chr3R 27901430 chr3R 18186549..18186836 49..336 1410 99.3 Plus
chr3R 27901430 chr3R 18186441..18186490 1..50 235 98 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:55:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:00:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22363354..22364132 332..1110 3865 99.7 Plus
3R 32079331 3R 22364197..22364581 1106..1490 1925 100 Plus
3R 32079331 3R 22363005..22363292 49..336 1410 99.3 Plus
3R 32079331 3R 22362897..22362946 1..50 235 98 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:52:47
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 22104185..22104963 332..1110 3865 99.7 Plus
3R 31820162 3R 22105028..22105412 1106..1490 1925 100 Plus
3R 31820162 3R 22103836..22104123 49..336 1410 99.3 Plus
3R 31820162 3R 22103728..22103777 1..50 235 98 Plus
Blast to na_te.dros performed on 2019-03-16 23:00:32 has no hits.

RE40914.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:01:18 Download gff for RE40914.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 18186441..18186490 1..50 98 -> Plus
chr3R 18186551..18186831 51..331 99 -> Plus
chr3R 18186898..18187671 332..1105 99 -> Plus
chr3R 18187735..18188118 1106..1489 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:15:37 Download gff for RE40914.complete
Subject Subject Range Query Range Percent Splice Strand
CG7071-RB 1..909 508..1416 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:33:51 Download gff for RE40914.complete
Subject Subject Range Query Range Percent Splice Strand
CG7071-RB 1..909 508..1416 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:18:24 Download gff for RE40914.complete
Subject Subject Range Query Range Percent Splice Strand
CG7071-RA 1..909 508..1416 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:06:10 Download gff for RE40914.complete
Subject Subject Range Query Range Percent Splice Strand
CG7071-RB 1..909 508..1416 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:45:47 Download gff for RE40914.complete
Subject Subject Range Query Range Percent Splice Strand
CG7071-RA 1..909 508..1416 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:59:40 Download gff for RE40914.complete
Subject Subject Range Query Range Percent Splice Strand
CG34131-RA 1..1489 1..1489 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:33:51 Download gff for RE40914.complete
Subject Subject Range Query Range Percent Splice Strand
muted-RA 1..1489 1..1489 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:18:24 Download gff for RE40914.complete
Subject Subject Range Query Range Percent Splice Strand
muted-RA 1..1489 1..1489 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:06:10 Download gff for RE40914.complete
Subject Subject Range Query Range Percent Splice Strand
CG34131-RA 1..1489 1..1489 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:45:47 Download gff for RE40914.complete
Subject Subject Range Query Range Percent Splice Strand
Muted-RB 278..1766 1..1489 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:01:18 Download gff for RE40914.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22362897..22362946 1..50 98 -> Plus
3R 22363007..22363287 51..331 99 -> Plus
3R 22363354..22364127 332..1105 99 -> Plus
3R 22364197..22364580 1106..1489 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:01:18 Download gff for RE40914.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22362897..22362946 1..50 98 -> Plus
3R 22363007..22363287 51..331 99 -> Plus
3R 22363354..22364127 332..1105 99 -> Plus
3R 22364197..22364580 1106..1489 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:01:18 Download gff for RE40914.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22362897..22362946 1..50 98 -> Plus
3R 22363007..22363287 51..331 99 -> Plus
3R 22363354..22364127 332..1105 99 -> Plus
3R 22364197..22364580 1106..1489 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:18:24 Download gff for RE40914.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18188619..18188668 1..50 98 -> Plus
arm_3R 18188729..18189009 51..331 99 -> Plus
arm_3R 18189076..18189849 332..1105 99 -> Plus
arm_3R 18189919..18190302 1106..1489 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:40:01 Download gff for RE40914.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22103838..22104118 51..331 99 -> Plus
3R 22104185..22104958 332..1105 99 -> Plus
3R 22105028..22105411 1106..1489 100   Plus
3R 22103728..22103777 1..50 98 -> Plus

RE40914.hyp Sequence

Translation from 507 to 1415

> RE40914.hyp
MLKSTIVDPRVRLVPSKKLLDFLDAQKKHLKELPENVAKIMKQRGHTLPT
SIRIIKDAGLEYKRPKLNYELLTKLTENLADKPEEPAKDKSEPDSGVKDS
DDAKSTREVKHFLYLTDLHWLSKTLAELRRQDHCQVFLHQLIESCDLLLP
ENEMKPRNPELEARCQRLRAEQQNRDYLKMTKNVDAGLKHYPEDTISYQI
KSLNKQIIAVVQFIFSVAAGFTFGFFGVNLMVGPLPFGFRILLGVIVALI
IALAEMYFLAKKLHEYDEVLDAPKRKPQPSTPAKRTPPAEGSQVQTLKPH
VD*

RE40914.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:47:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG7071-PC 302 CG7071-PC 1..302 1..302 1557 100 Plus
CG7071-PB 302 CG7071-PB 1..302 1..302 1557 100 Plus
CG7071-PA 302 CG7071-PA 1..302 1..302 1557 100 Plus

RE40914.pep Sequence

Translation from 507 to 1415

> RE40914.pep
MLKSTIVDPRVRLVPSKKLLDFLDAQKKHLKELPENVAKIMKQRGHTLPT
SIRIIKDAGLEYKRPKLNYELLTKLTENLADKPEEPAKDKSEPDSGVKDS
DDAKSTREVKHFLYLTDLHWLSKTLAELRRQDHCQVFLHQLIESCDLLLP
ENEMKPRNPELEARCQRLRAEQQNRDYLKMTKNVDAGLKHYPEDTISYQI
KSLNKQIIAVVQFIFSVAAGFTFGFFGVNLMVGPLPFGFRILLGVIVALI
IALAEMYFLAKKLHEYDEVLDAPKRKPQPSTPAKRTPPAEGSQVQTLKPH
VD*

RE40914.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:00:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18081-PA 298 GF18081-PA 1..298 1..302 1089 70.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:00:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11121-PA 441 GG11121-PA 137..441 1..302 1393 85.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:00:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21152-PA 291 GH21152-PA 1..291 1..302 1032 67.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG7071-PC 302 CG7071-PC 1..302 1..302 1557 100 Plus
CG7071-PB 302 CG7071-PB 1..302 1..302 1557 100 Plus
CG7071-PA 302 CG7071-PA 1..302 1..302 1557 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:00:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10478-PA 291 GI10478-PA 1..291 1..302 983 66.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:00:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23377-PA 313 GL23377-PA 1..313 1..302 1080 67.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:00:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20078-PA 313 GA20078-PA 1..313 1..302 1064 67.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:00:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26419-PA 302 GM26419-PA 1..302 1..302 1543 96.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:00:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20938-PA 302 GD20938-PA 1..302 1..302 1544 96.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:00:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23158-PA 287 GJ23158-PA 1..287 1..302 1037 67.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:00:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12992-PA 303 GK12992-PA 1..303 1..302 970 63 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:00:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10288-PA 308 GE10288-PA 1..308 1..302 1389 85.7 Plus