Clone RE41154 Report

Search the DGRC for RE41154

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:411
Well:54
Vector:pFlc-1
Associated Gene/TranscriptCG17508-RA
Protein status:RE41154.pep: gold
Sequenced Size:1239

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17508-RA 2011-07-29 Manual selection by Sue Celniker

Clone Sequence Records

RE41154.complete Sequence

1239 bp assembled on 2011-09-16

GenBank Submission: BT128906.1

> RE41154.complete
GCTTGTAGTTGGGTTGGTTAGTCGGCTTGATAAGTTTAATCAGAATAAGC
TTTTATTTTGCATTTGCCAAATACAATGTACATCACAACGGGCAAAACGT
TTGCGGTGCTGAAAGGACCTTTACGTGATTGTTTTTTTCTTAGTAAGAGA
TGGCCAGCTGTTCAACAACTGCACTTAAGTGTCGCAATGGGAAATTATGT
GAATGAAGCCTCAATTCCCCTTCCAATCAATGTGGACTCTGCGGAAACAA
CTCGATTCTCCCCCCAGCGCTCGCGTGACATTTCGTCTACAGTGATTAAT
GCACAAGCACCAATCTCAAGCATTGATATCACAACTGACAACAGTTTTCA
TGCAGTCCTAAGCGATCCAAATATTTGTCAAGATCCACATGTACAGTCCT
ATGATTGTTTCGGGTTGATCAGTCTTAATTCCGCGATGCAAAGCAATGTA
CCAACACCGTTTGGGGGGCTTAACAAGTTTTCTCATCTGAACATGCCTGG
CGGACAATGGTCCCAGGAATTCAAGTTTACAGCGCAAAACATGCAGTGCT
CTCACTACAGCGGTCTTCGCGAAAGTTTGCGAGCGGATTGGGCGACTTAC
GATCAGAATGCTACTCTTAAAACGAATGACCAAGGGTTGTTTAATCGAAG
ATATTATAGCACCCAATCACCTATGCAAAACTCTTCCACAAAAACACCTA
CAGGTGCAAAACTAAGTAAAAGTGAGCAGCTGAAGAGGGCATTTAAGGAA
TATGGAGCGCCAATTGTTGCGTTTCACGTAGGAATTTCACTGATTTCTCT
TGCCGGTTTCTATGTGCTTGTATCAAGTGGCATAAACTTGGTCCCAGCTC
TGGAGTGTATTGGAATTGCATCACCCGCTATTGTAGAAAAAGTGGCAACG
GGGAGCACCTTTGTTGTTGCGTATGCCGTACACAAAGTCTTTGCCCCTGC
TAGAATAAGTATCACGTTAGGTTCTGTGCCATTTGTTGTACGCTATATTC
GATCTAAGAAATCGCAAATACCAAAGCCAAAAAATACTTAGAGTTGAGAA
CAATGAAGTCCTTTCAATAAGGGATTTCATTTTTTATAATTTGTTTTTTA
AAGTTTAGATGGAAATGTTTATTTGTAGGAAAAGCGTACTACTACCATCT
AGGCAGATTAATCTAATGAGAAATTATTTGCTTAGCTATTCAAAGCAATG
AAAAGACGAGGTTTATAAAGCGGTAAAAAAAAAAAAAAA

RE41154.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:01:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 1496384..1496863 156..635 2400 100 Plus
chr2R 21145070 chr2R 1498563..1498959 826..1222 1985 100 Plus
chr2R 21145070 chr2R 1497435..1497629 633..827 975 100 Plus
chr2R 21145070 chr2R 1496014..1496170 1..157 785 100 Plus
chrX 22417052 chrX 21007656..21007737 1094..1175 305 91.5 Plus
chr2L 23010047 chr2L 3128713..3128965 713..965 305 74.7 Plus
chrX 22417052 chrX 21034568..21034639 1175..1104 240 88.9 Minus
chr3L 24539361 chr3L 19991863..19991918 1119..1174 220 92.9 Plus
chr4 1351717 chr4 1264654..1264706 1094..1146 190 90.6 Plus
chr3R 27901430 chr3R 1558349..1558407 1117..1175 190 88.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:01:53
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 5609011..5609490 156..635 2400 100 Plus
2R 25286936 2R 5611190..5611586 826..1222 1985 100 Plus
2R 25286936 2R 5610062..5610256 633..827 975 100 Plus
2R 25286936 2R 5608641..5608797 1..157 785 100 Plus
2L 23513712 2L 3129045..3129297 713..965 320 75.1 Plus
X 23542271 X 21142499..21142580 1094..1175 305 91.5 Plus
X 23542271 X 21169411..21169482 1175..1104 240 88.9 Minus
3L 28110227 3L 20002549..20002604 1119..1174 220 92.9 Plus
4 1348131 4 1261072..1261124 1094..1146 190 90.6 Plus
3R 32079331 3R 5732702..5732760 1117..1175 190 88.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:01:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 5610210..5610689 156..635 2400 100 Plus
2R 25260384 2R 5612389..5612785 826..1222 1985 100 Plus
2R 25260384 2R 5611261..5611455 633..827 975 100 Plus
2R 25260384 2R 5609840..5609996 1..157 785 100 Plus
2L 23513712 2L 3129045..3129297 713..965 320 75 Plus
X 23527363 X 21127591..21127672 1094..1175 305 91.4 Plus
X 23527363 X 21154503..21154574 1175..1104 240 88.8 Minus
3L 28103327 3L 19995649..19995704 1119..1174 220 92.8 Plus
X 23527363 X 16713795..16713852 1170..1116 190 91.3 Minus
4 1331231 4 1244172..1244224 1094..1146 190 90.5 Plus
3R 31820162 3R 5473533..5473591 1117..1175 190 88.1 Plus
Blast to na_te.dros performed on 2019-03-15 11:01:53 has no hits.

RE41154.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:02:43 Download gff for RE41154.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 1496014..1496170 1..157 100 -> Plus
chr2R 1496386..1496862 158..634 100 -> Plus
chr2R 1497437..1497629 635..827 100 -> Plus
chr2R 1498565..1498961 828..1224 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-09-16 11:35:39 Download gff for RE41154.complete
Subject Subject Range Query Range Percent Splice Strand
CG17508-RA 1..966 76..1041 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:34:07 Download gff for RE41154.complete
Subject Subject Range Query Range Percent Splice Strand
CG17508-RA 1..966 76..1041 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:20:16 Download gff for RE41154.complete
Subject Subject Range Query Range Percent Splice Strand
CG17508-RA 1..966 76..1041 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-16 11:35:39 Download gff for RE41154.complete
Subject Subject Range Query Range Percent Splice Strand
CG17508-RA 18..1241 1..1224 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:34:07 Download gff for RE41154.complete
Subject Subject Range Query Range Percent Splice Strand
CG17508-RA 7..1228 1..1222 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:20:16 Download gff for RE41154.complete
Subject Subject Range Query Range Percent Splice Strand
CG17508-RA 7..1228 1..1222 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:02:43 Download gff for RE41154.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5610064..5610256 635..827 100 -> Plus
2R 5608641..5608797 1..157 100 -> Plus
2R 5609013..5609489 158..634 100 -> Plus
2R 5611192..5611588 828..1224 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:02:43 Download gff for RE41154.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5610064..5610256 635..827 100 -> Plus
2R 5608641..5608797 1..157 100 -> Plus
2R 5609013..5609489 158..634 100 -> Plus
2R 5611192..5611588 828..1224 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:02:43 Download gff for RE41154.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5610064..5610256 635..827 100 -> Plus
2R 5608641..5608797 1..157 100 -> Plus
2R 5609013..5609489 158..634 100 -> Plus
2R 5611192..5611588 828..1224 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:34:07 Download gff for RE41154.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 1496146..1496302 1..157 100 -> Plus
arm_2R 1496518..1496994 158..634 100 -> Plus
arm_2R 1497569..1497761 635..827 100 -> Plus
arm_2R 1498697..1499093 828..1224 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:48:44 Download gff for RE41154.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5610212..5610688 158..634 100 -> Plus
2R 5611263..5611455 635..827 100 -> Plus
2R 5612391..5612787 828..1224 99   Plus
2R 5609840..5609996 1..157 100 -> Plus

RE41154.hyp Sequence

Translation from 75 to 1040

> RE41154.hyp
MYITTGKTFAVLKGPLRDCFFLSKRWPAVQQLHLSVAMGNYVNEASIPLP
INVDSAETTRFSPQRSRDISSTVINAQAPISSIDITTDNSFHAVLSDPNI
CQDPHVQSYDCFGLISLNSAMQSNVPTPFGGLNKFSHLNMPGGQWSQEFK
FTAQNMQCSHYSGLRESLRADWATYDQNATLKTNDQGLFNRRYYSTQSPM
QNSSTKTPTGAKLSKSEQLKRAFKEYGAPIVAFHVGISLISLAGFYVLVS
SGINLVPALECIGIASPAIVEKVATGSTFVVAYAVHKVFAPARISITLGS
VPFVVRYIRSKKSQIPKPKNT*

RE41154.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:34:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG17508-PA 321 CG17508-PA 1..321 1..321 1659 100 Plus
CG17508-PB 194 CG17508-PB 1..187 1..187 993 100 Plus
CG15403-PA 200 CG15403-PA 53..200 164..321 421 60.1 Plus

RE41154.pep Sequence

Translation from 75 to 1040

> RE41154.pep
MYITTGKTFAVLKGPLRDCFFLSKRWPAVQQLHLSVAMGNYVNEASIPLP
INVDSAETTRFSPQRSRDISSTVINAQAPISSIDITTDNSFHAVLSDPNI
CQDPHVQSYDCFGLISLNSAMQSNVPTPFGGLNKFSHLNMPGGQWSQEFK
FTAQNMQCSHYSGLRESLRADWATYDQNATLKTNDQGLFNRRYYSTQSPM
QNSSTKTPTGAKLSKSEQLKRAFKEYGAPIVAFHVGISLISLAGFYVLVS
SGINLVPALECIGIASPAIVEKVATGSTFVVAYAVHKVFAPARISITLGS
VPFVVRYIRSKKSQIPKPKNT*

RE41154.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:33:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19740-PA 67 GF19740-PA 1..67 255..321 192 56.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:33:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23170-PA 329 GG23170-PA 1..328 1..315 1475 85.1 Plus
Dere\GG24922-PA 135 GG24922-PA 14..135 194..321 425 69.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:33:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13417-PA 333 GH13417-PA 1..333 1..321 937 57.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:06:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG17508-PA 321 CG17508-PA 1..321 1..321 1659 100 Plus
CG17508-PB 194 CG17508-PB 1..187 1..187 993 100 Plus
CG15403-PA 200 CG15403-PA 53..200 164..321 421 60.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:33:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17654-PA 320 GI17654-PA 5..317 24..315 933 60.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:33:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21148-PA 356 GL21148-PA 50..346 23..311 1009 68.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:33:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA29089-PA 356 GA29089-PA 50..346 23..311 1000 68.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:33:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18396-PA 135 GM18396-PA 4..135 183..321 434 66.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:33:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10376-PA 321 GD10376-PA 1..321 1..321 1574 92.2 Plus
Dsim\GD23209-PA 134 GD23209-PA 4..134 184..321 432 65.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:33:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18221-PA 317 GJ18221-PA 1..317 1..321 963 61.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:33:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15336-PA 346 GK15336-PA 1..345 1..320 1043 61.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:33:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11308-PA 319 GE11308-PA 1..319 1..315 1374 82.2 Plus
Dyak\GE18212-PA 198 GE18212-PA 77..198 194..321 427 69.5 Plus