Clone RE41194 Report

Search the DGRC for RE41194

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:411
Well:94
Vector:pFlc-1
Associated Gene/TranscriptCG15043-RA
Protein status:RE41194.pep: gold
Preliminary Size:492
Sequenced Size:690

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15043 2002-01-01 Sim4 clustering to Release 2
CG15043 2002-04-21 Blastp of sequenced clone
CG15043 2003-01-01 Sim4 clustering to Release 3
CG15043 2008-04-29 Release 5.5 accounting
CG15043 2008-08-15 Release 5.9 accounting
CG15043 2008-12-18 5.12 accounting

Clone Sequence Records

RE41194.complete Sequence

690 bp (690 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113466

> RE41194.complete
ATTCGGTGACTTCAACGTGCCGTGACTGGAGACCCTTAGTCCACACACTT
CGTTTACCTCGAATTTCAATTCAACGCCCAAGATGTCCAAGTTTAGCCTC
ATCCTGTTGTCCGCCCTGCTGGGCTGTCTTGTGTCCGGTGGAGCGGCTGG
AACAATACGTGTGGATACCACCGGCATCCAAGTGGTGGATAATATCCATG
TCTTTGCCGCCCAATACCCGGGTCTGCAGATCCAGCAGATGGAGAAGGAA
ATTGTGCCGGCCAAGGCCCGCGTCGGAAGCCAGACCGTGCGCTACAACAT
GGGAGCCCGCATTCCGGGCGACGAACTGGTGGCCCAGACAGCCAACACTT
ACGAATTCCCACGGGCGCAAGATGTGAGCCTGCAGCTTACCTATCCGGAG
AACGGCAAGGGTGCCACTGTATCCTACGTGGAGCTGCTCTGCACCCAGGA
CACCAACGAGGGCACCGCCTACGTGGTCGCCGGAGGCATCGGCCAGAGCT
TGATCTCCATCGTGCTGGAGGCCAAGAACACCAAGAACTTCTCATACCAG
GCTCTCTACTACGGAGTCAACTAGGAGGCATTTGCATTAGTTCCTCGCTA
GCTTTATATATATATATATTTTTTTTTTTTTTAAATGTGACTCCAATTTT
AAATACATATGTATAATGGCAGACTAAAAAAAAAAAAAAA

RE41194.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:13:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG15043-RA 1065 CG15043-RA 219..898 1..679 3345 99.7 Plus
CG15043.a 1302 CG15043.a 456..1135 1..679 3345 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:18:04
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 18382527..18382885 675..317 1795 100 Minus
chrX 22417052 chrX 18382957..18383274 318..1 1575 99.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:55:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:18:02
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18493412..18493775 679..317 1770 99.7 Minus
X 23542271 X 18493847..18494164 318..1 1575 99.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:44:07
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 18501510..18501873 679..317 1780 99.7 Minus
X 23527363 X 18501945..18502262 318..1 1575 99.6 Minus
Blast to na_te.dros performed on 2019-03-16 07:18:02 has no hits.

RE41194.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:18:48 Download gff for RE41194.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 18382958..18383274 1..317 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:15:58 Download gff for RE41194.complete
Subject Subject Range Query Range Percent Splice Strand
CG15043-RA 1..492 83..574 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:59:43 Download gff for RE41194.complete
Subject Subject Range Query Range Percent Splice Strand
CG15043-RA 1..492 83..574 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:30:50 Download gff for RE41194.complete
Subject Subject Range Query Range Percent Splice Strand
CG15043-RA 1..492 83..574 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:53:04 Download gff for RE41194.complete
Subject Subject Range Query Range Percent Splice Strand
CG15043-RA 1..492 83..574 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:30:49 Download gff for RE41194.complete
Subject Subject Range Query Range Percent Splice Strand
CG15043-RA 1..492 83..574 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:40:33 Download gff for RE41194.complete
Subject Subject Range Query Range Percent Splice Strand
CG15043-RA 1..676 1..675 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:59:43 Download gff for RE41194.complete
Subject Subject Range Query Range Percent Splice Strand
CG15043-RA 1..676 1..675 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:30:50 Download gff for RE41194.complete
Subject Subject Range Query Range Percent Splice Strand
CG15043-RA 5..680 1..675 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:53:04 Download gff for RE41194.complete
Subject Subject Range Query Range Percent Splice Strand
CG15043-RA 1..676 1..675 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:30:49 Download gff for RE41194.complete
Subject Subject Range Query Range Percent Splice Strand
CG15043-RA 5..680 1..675 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:18:48 Download gff for RE41194.complete
Subject Subject Range Query Range Percent Splice Strand
X 18493416..18493774 318..675 99 <- Minus
X 18493848..18494164 1..317 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:18:48 Download gff for RE41194.complete
Subject Subject Range Query Range Percent Splice Strand
X 18493416..18493774 318..675 99 <- Minus
X 18493848..18494164 1..317 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:18:48 Download gff for RE41194.complete
Subject Subject Range Query Range Percent Splice Strand
X 18493416..18493774 318..675 99 <- Minus
X 18493848..18494164 1..317 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:30:50 Download gff for RE41194.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18387449..18387807 318..675 99 <- Minus
arm_X 18387881..18388197 1..317 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:25:09 Download gff for RE41194.complete
Subject Subject Range Query Range Percent Splice Strand
X 18501514..18501872 318..675 99 <- Minus
X 18501946..18502262 1..317 99   Minus

RE41194.pep Sequence

Translation from 82 to 573

> RE41194.pep
MSKFSLILLSALLGCLVSGGAAGTIRVDTTGIQVVDNIHVFAAQYPGLQI
QQMEKEIVPAKARVGSQTVRYNMGARIPGDELVAQTANTYEFPRAQDVSL
QLTYPENGKGATVSYVELLCTQDTNEGTAYVVAGGIGQSLISIVLEAKNT
KNFSYQALYYGVN*

RE41194.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:37:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22411-PA 157 GF22411-PA 1..156 1..161 507 63 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:37:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18115-PA 163 GG18115-PA 14..163 14..163 679 84.7 Plus
Dere\GG18116-PA 156 GG18116-PA 3..155 7..161 135 23.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:37:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12337-PA 162 GH12337-PA 1..160 1..161 448 54.6 Plus
Dgri\GH12339-PA 166 GH12339-PA 36..165 27..161 178 30.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:29:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG15043-PB 163 CG15043-PB 1..163 1..163 820 100 Plus
CG15043-PA 163 CG15043-PA 1..163 1..163 820 100 Plus
CG15044-PA 160 CG15044-PA 7..159 7..161 153 25.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:37:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15587-PA 164 GI15587-PA 1..162 1..161 448 56.4 Plus
Dmoj\GI15588-PA 170 GI15588-PA 68..169 61..161 154 32.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:37:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27028-PA 166 GL27028-PA 15..164 13..161 452 56.6 Plus
Dper\GL27029-PA 157 GL27029-PA 41..156 41..161 153 27 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:37:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13455-PA 166 GA13455-PA 15..164 13..161 454 57.2 Plus
Dpse\GA13456-PA 157 GA13456-PA 41..156 41..161 153 27 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:37:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22808-PA 163 GM22808-PA 14..163 14..163 741 92.7 Plus
Dsec\GM22809-PA 156 GM22809-PA 45..155 46..161 150 29.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:37:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15631-PA 163 GD15631-PA 14..163 14..163 747 94 Plus
Dsim\GD15632-PA 156 GD15632-PA 45..155 46..161 150 29.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:37:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15191-PA 162 GJ15191-PA 1..162 1..163 466 57 Plus
Dvir\GJ15192-PA 140 GJ15192-PA 13..139 30..161 171 29.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:37:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25257-PA 169 GK25257-PA 1..169 1..163 471 56.4 Plus
Dwil\GK25258-PA 156 GK25258-PA 39..155 44..161 135 26.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:37:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15520-PA 164 GE15520-PA 14..164 14..163 642 82.1 Plus
Dyak\GE15521-PA 157 GE15521-PA 30..156 30..161 151 27.8 Plus

RE41194.hyp Sequence

Translation from 82 to 573

> RE41194.hyp
MSKFSLILLSALLGCLVSGGAAGTIRVDTTGIQVVDNIHVFAAQYPGLQI
QQMEKEIVPAKARVGSQTVRYNMGARIPGDELVAQTANTYEFPRAQDVSL
QLTYPENGKGATVSYVELLCTQDTNEGTAYVVAGGIGQSLISIVLEAKNT
KNFSYQALYYGVN*

RE41194.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:44:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG15043-PB 163 CG15043-PB 1..163 1..163 820 100 Plus
CG15043-PA 163 CG15043-PA 1..163 1..163 820 100 Plus
CG15044-PA 160 CG15044-PA 7..159 7..161 153 25.8 Plus